Rattus norvegicus (rat): 288386 Help Entry 288386            CDS       T01003                                  Symbol Cd209cl2 Name (RefSeq) CD209 antigen-like protein C   KO K06563   C-type lectin domain family 4 member L/M Organism rno  Rattus norvegicus (rat) Pathway rno03260   Virion - Human immunodeficiency virus rno03264   Virion - Flavivirus and Alphavirus rno03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus rno03273   Virion - Lassa virus and SFTS virus rno04145   Phagocytosis rno04517   IgSF CAM signaling rno04625   C-type lectin receptor signaling pathway rno05152   Tuberculosis rno05162   Measles Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     288386 (Cd209cl2)    03264 Virion - Flavivirus and Alphavirus     288386 (Cd209cl2)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     288386 (Cd209cl2)    03273 Virion - Lassa virus and SFTS virus     288386 (Cd209cl2)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     288386 (Cd209cl2)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     288386 (Cd209cl2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     288386 (Cd209cl2)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     288386 (Cd209cl2)   09171 Infectious disease: bacterial    05152 Tuberculosis     288386 (Cd209cl2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rno04131]     288386 (Cd209cl2)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:rno04054]     288386 (Cd209cl2)    04515 Cell adhesion molecules [BR:rno04515]     288386 (Cd209cl2)    04090 CD molecules [BR:rno04090]     288386 (Cd209cl2)    04091 Lectins [BR:rno04091]     288386 (Cd209cl2) Membrane trafficking [BR:rno04131]  Endocytosis   Phagocytosis    C-lectin receptors     288386 (Cd209cl2) Pattern recognition receptors [BR:rno04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    288386 (Cd209cl2) Cell adhesion molecules [BR:rno04515]  Lectins   Selectins and C-type lectins    288386 (Cd209cl2) CD molecules [BR:rno04090]  Proteins   288386 (Cd209cl2) Lectins [BR:rno04091]  C-Type lectins   Asialoglycoprotein and DC receptors    288386 (Cd209cl2) SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  288386 NCBI-ProteinID:  XP_038945830 RGD:  1559710 LinkDB All DBs Position 12:complement(7020707..7034518) Genome browser AA seq 250 aa AA seqDB search MSNSKKVRELKTSGIRSSSKGSGLQPSFELYRFSVVSVSSSQSEEHIYTEVTEVKPKIGC VRHGLVPLVLQLLFFTLFSGVLVTFLLQVPKVPCTKDQEEIYKKLTQLKTRIDLLCRPCS WDWMLFHGNCYFFSITKHNWNDSLTACKEVGAQLIIIESDEEQTFLQKMCKSIGNLWIGL SDIKEEGSWQWVDGSPLSLSFKNKYWTPWETKNASEKDCVELTNDGWNDNNCTLKNFWIC KKSSISCFKN NT seq 753 nt NT seq  +upstreamnt  +downstreamnt atgagtaactccaagaaagtcagggaattgaagaccagtggcatcagatcttcctctaag ggctctgggctccagccaagttttgaactttatagattttcagttgtcagtgtctccagt tcccagagtgaagagcatatctatactgaagtgacagaggtaaaacctaaaattgggtgt gtgagacatggccttgttcccttggtgctgcagctgcttttcttcactctcttctctggg gtccttgtgacatttcttctccaagttccaaaggtgccctgcaccaaggatcaggaggaa atctacaagaaactcacacaactgaagactcgaatagacctcctatgtcgtccctgctcc tgggactggatgcttttccatggaaattgttacttcttctccataactaaacataactgg aatgattctctcactgcttgcaaggaagtaggggcacaactcatcatcattgaaagtgat gaggagcagacctttctacagaagatgtgtaagagtataggaaatctctggattgggctc tcagacataaaagaggaaggctcatggcagtgggtggatggttcacctctgtcactaagc tttaaaaacaaatattggaccccgtgggaaaccaaaaatgcttcagagaaagactgtgta gagctgacaaatgatggctggaatgacaacaattgtacattgaagaatttctggatctgc aagaaatcgtcaatatcgtgcttcaaaaattga

DBGET integrated database retrieval system