KEGG   Rattus norvegicus (rat): 292892
Entry
292892            CDS       T01003                                 
Symbol
Irf3
Name
(RefSeq) interferon regulatory factor 3
  KO
K05411  interferon regulatory factor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04936  Alcoholic liver disease
rno05133  Pertussis
rno05135  Yersinia infection
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05203  Viral carcinogenesis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    292892 (Irf3)
   04621 NOD-like receptor signaling pathway
    292892 (Irf3)
   04622 RIG-I-like receptor signaling pathway
    292892 (Irf3)
   04623 Cytosolic DNA-sensing pathway
    292892 (Irf3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    292892 (Irf3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    292892 (Irf3)
   05161 Hepatitis B
    292892 (Irf3)
   05160 Hepatitis C
    292892 (Irf3)
   05171 Coronavirus disease - COVID-19
    292892 (Irf3)
   05164 Influenza A
    292892 (Irf3)
   05162 Measles
    292892 (Irf3)
   05168 Herpes simplex virus 1 infection
    292892 (Irf3)
   05163 Human cytomegalovirus infection
    292892 (Irf3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    292892 (Irf3)
   05169 Epstein-Barr virus infection
    292892 (Irf3)
   05165 Human papillomavirus infection
    292892 (Irf3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    292892 (Irf3)
   05133 Pertussis
    292892 (Irf3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    292892 (Irf3)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    292892 (Irf3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    292892 (Irf3)
   04131 Membrane trafficking [BR:rno04131]
    292892 (Irf3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    292892 (Irf3)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    292892 (Irf3)
SSDB
Motif
Pfam: IRF-3 IRF YoeB_toxin
Other DBs
NCBI-GeneID: 292892
NCBI-ProteinID: NP_001006970
RGD: 1549774
Ensembl: ENSRNOG00000043388
UniProt: Q5XIB0 F7EXX5
LinkDB
Position
1:95479966..95484926
AA seq 421 aa
MGTPKPLILPWLVSQLDLGQLKGVAWLDESRTKFRIPWKHGLRQDAQMADFGIFQAWAEA
SGAYTPGKDKPDLSTWKRNFRSALNRKEVLRLAEDRSKDPFDPHKVYEFVTPGGARDFVH
LDTSPDTNGKSSLSDHQEDLLELLDHMALGPLPDEGSSDLPIASDPSQPPLSPIVNNFPN
PAPQENPLRQLLAEEQWEFEVTAFYRGRQVFQQTLFCPGGLRLVGSTSDNGTLPWQPVTL
PDPEEFLTDRLVREYVRQVLKGLGKGLVLWRAGQCLWAQRLGHSHSFWALGEELLPDSGR
GPDGEVPKDKNGVVFDLRPFVADLIAFMEGSRHSPRYTLWFCVGESWPQDQPWVKRLVMV
KVVPTCLKELLEMAREGGASSLKTVDLHISNSQPISLTSDQYKACLQDLVEDMDFQATGE
T
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgggaaccccgaaaccgctgattttgccttggctggtgtctcagctggacctgggacag
ctgaaaggtgtggcctggctggacgagagccgtacaaagttcaggatcccatggaagcat
ggcttacgacaggacgcacagatggctgactttggcatcttccaggcctgggcggaagcc
agtggtgcctacaccccagggaaggataagccagacctgtcaacctggaagaggaatttc
cggtcagccctgaaccggaaagaagtgttgcgattagctgaggaccggagcaaggaccct
tttgaccctcataaagtgtatgagtttgtgactccaggaggagcaagggactttgtacat
ctggacacctcccctgacaccaatggcaaaagcagtctgtctgatcaccaggaagacctc
ttggaattactcgatcacatggccttgggacccctcccagatgaggggtcctcagacctg
cctattgcttctgatccttctcaaccaccactaagccccattgtaaacaacttcccaaac
ccagcaccccaggaaaacccactaaggcagctgctagctgaggaacagtgggagttcgag
gtgactgccttctaccgaggccgccaggtcttccagcagacactcttttgccccgggggc
ctgcggctggtgggcagcacgtctgacaacgggacactgccctggcagccagtcaccctg
ccagaccctgaggagtttctgacagacaggcttgtgagggagtatgtgaggcaggtactc
aaggggctgggcaaggggctggtgctgtggcgggcagggcagtgcctctgggcccagcgc
ctaggccactcgcattccttctgggccctgggtgaggagctgcttccagacagtgggaga
gggcctgatggagaggtccccaaggacaagaacggagtcgtgttcgacctcaggcccttt
gtggcagatctcattgccttcatggaaggaagcagacattccccacgatacactctgtgg
ttctgtgtgggggaatcgtggccccaggaccagccgtgggtcaagaggcttgtgatggtc
aaggttgttcctacatgtcttaaggagctgttagagatggcccgggaagggggagcctca
tcactgaaaaccgtggacttgcacatctccaacagccagccgatctcccttacctctgac
cagtacaaggcctgcctccaggacttggtggaagacatggacttccaggccactggagaa
acctga

DBGET integrated database retrieval system