Rattus norvegicus (rat): 294269 Help Entry 294269            CDS       T01003                                  Symbol RT1-Da Name (RefSeq) RT1 class II, locus Da precursor   KO K06752   MHC class II antigen Organism rno  Rattus norvegicus (rat) Pathway rno04145   Phagosome rno04514   Cell adhesion molecule (CAM) interaction rno04612   Antigen processing and presentation rno04640   Hematopoietic cell lineage rno04658   Th1 and Th2 cell differentiation rno04659   Th17 cell differentiation rno04672   Intestinal immune network for IgA production rno04940   Type I diabetes mellitus rno05140   Leishmaniasis rno05145   Toxoplasmosis rno05150   Staphylococcus aureus infection rno05152   Tuberculosis rno05164   Influenza A rno05166   Human T-cell leukemia virus 1 infection rno05168   Herpes simplex virus 1 infection rno05169   Epstein-Barr virus infection rno05310   Asthma rno05320   Autoimmune thyroid disease rno05321   Inflammatory bowel disease rno05322   Systemic lupus erythematosus rno05323   Rheumatoid arthritis rno05330   Allograft rejection rno05332   Graft-versus-host disease rno05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     294269 (RT1-Da)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     294269 (RT1-Da)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     294269 (RT1-Da)    04612 Antigen processing and presentation     294269 (RT1-Da)    04658 Th1 and Th2 cell differentiation     294269 (RT1-Da)    04659 Th17 cell differentiation     294269 (RT1-Da)    04672 Intestinal immune network for IgA production     294269 (RT1-Da)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     294269 (RT1-Da)    05164 Influenza A     294269 (RT1-Da)    05168 Herpes simplex virus 1 infection     294269 (RT1-Da)    05169 Epstein-Barr virus infection     294269 (RT1-Da)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     294269 (RT1-Da)    05152 Tuberculosis     294269 (RT1-Da)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     294269 (RT1-Da)    05140 Leishmaniasis     294269 (RT1-Da)   09163 Immune disease    05310 Asthma     294269 (RT1-Da)    05322 Systemic lupus erythematosus     294269 (RT1-Da)    05323 Rheumatoid arthritis     294269 (RT1-Da)    05320 Autoimmune thyroid disease     294269 (RT1-Da)    05321 Inflammatory bowel disease     294269 (RT1-Da)    05330 Allograft rejection     294269 (RT1-Da)    05332 Graft-versus-host disease     294269 (RT1-Da)   09166 Cardiovascular disease    05416 Viral myocarditis     294269 (RT1-Da)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     294269 (RT1-Da)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rno04147]     294269 (RT1-Da) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    294269 (RT1-Da)   Exosomal proteins of epithelial cells    294269 (RT1-Da)   Exosomal proteins of breast milk    294269 (RT1-Da) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MHC_II_alpha C1-set Ig_3 Ig_2 C2-set_2 Saf_2TM Motif Other DBs NCBI-GeneID:  294269 NCBI-ProteinID:  NP_001008847 RGD:  1593283 Ensembl:  ENSRNOG00000032844 Vega:  OTTRNOG00000001680 UniProt:  Q6MG98 A0A023IKG5 LinkDB All DBs Position 20:4515393..4520387 Genome browser AA seq 255 aa AA seqDB search MATLGDLVIRFFFMAVLMSPQKSWAIREEHTIIQAEFYLSPDQNGEFMFDFDGDEIFHVD IKKSETIWRLEEFAQFASFEAQGALANIAVDKANLDIMIKRSNNTPDANVIPEVTVLPKS PVNLGEPNILICFIDKFSPPAVNVTWLRNGQPVTKGVSETVFLPREDHLFRKFHYLTFLP STEDYYDCEVDHWGLEEPLRKHWEFEEKTLLPETKENVLCVLGLFVGLVGIVVGIVLIIK GLRKRNAVERRQGAL NT seq 768 nt NT seq  +upstreamnt  +downstreamnt atggccacacttggagacctggtgataagatttttcttcatggctgtcctcatgagcccc cagaagtcgtgggctatcagagaggagcacaccatcatccaggcggagttctatctttcc cccgaccaaaatggagagttcatgtttgactttgacggtgacgagattttccatgtagat attaaaaagtcagagaccatctggagacttgaagaatttgcacagtttgccagctttgag gctcagggtgcattggctaatatagctgtggacaaagctaacctggacatcatgataaag cgctccaacaacactccagatgccaatgtgattccagaggtgactgtactccccaaaagc ccggtgaacctgggagagcccaacatcctcatctgtttcattgacaagttctcccctcca gcggtcaatgtcacctggcttcggaacggacaacctgtcaccaaaggcgtgtcagagacg gtgtttctcccaagggaggaccacctcttccgcaaattccactatctgaccttcctgccc tccacggaagattactatgactgtgaggtggatcactggggtctggaggagcctctgcgg aagcactgggagtttgaagagaaaaccctcctcccagaaactaaagagaatgtcctgtgt gttctcgggttgtttgtgggtctggtaggcatcgtcgtcgggattgtgctcatcatcaag ggccttcggaaacgcaacgcagtggaacggcgccaaggagccctgtga

DBGET integrated database retrieval system