Rattus norvegicus (rat): 294273 Help Entry 294273            CDS       T01003                                  Symbol RT1-DMb Name (RefSeq) RT1 class II, DM beta precursor   KO K06752   MHC class II antigen Organism rno  Rattus norvegicus (rat) Pathway rno04145   Phagosome rno04514   Cell adhesion molecules rno04612   Antigen processing and presentation rno04640   Hematopoietic cell lineage rno04658   Th1 and Th2 cell differentiation rno04659   Th17 cell differentiation rno04672   Intestinal immune network for IgA production rno04940   Type I diabetes mellitus rno05140   Leishmaniasis rno05145   Toxoplasmosis rno05150   Staphylococcus aureus infection rno05152   Tuberculosis rno05164   Influenza A rno05166   Human T-cell leukemia virus 1 infection rno05168   Herpes simplex virus 1 infection rno05169   Epstein-Barr virus infection rno05310   Asthma rno05320   Autoimmune thyroid disease rno05321   Inflammatory bowel disease rno05322   Systemic lupus erythematosus rno05323   Rheumatoid arthritis rno05330   Allograft rejection rno05332   Graft-versus-host disease rno05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     294273 (RT1-DMb)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     294273 (RT1-DMb)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     294273 (RT1-DMb)    04612 Antigen processing and presentation     294273 (RT1-DMb)    04658 Th1 and Th2 cell differentiation     294273 (RT1-DMb)    04659 Th17 cell differentiation     294273 (RT1-DMb)    04672 Intestinal immune network for IgA production     294273 (RT1-DMb)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     294273 (RT1-DMb)    05164 Influenza A     294273 (RT1-DMb)    05168 Herpes simplex virus 1 infection     294273 (RT1-DMb)    05169 Epstein-Barr virus infection     294273 (RT1-DMb)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     294273 (RT1-DMb)    05152 Tuberculosis     294273 (RT1-DMb)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     294273 (RT1-DMb)    05140 Leishmaniasis     294273 (RT1-DMb)   09163 Immune disease    05310 Asthma     294273 (RT1-DMb)    05322 Systemic lupus erythematosus     294273 (RT1-DMb)    05323 Rheumatoid arthritis     294273 (RT1-DMb)    05320 Autoimmune thyroid disease     294273 (RT1-DMb)    05321 Inflammatory bowel disease     294273 (RT1-DMb)    05330 Allograft rejection     294273 (RT1-DMb)    05332 Graft-versus-host disease     294273 (RT1-DMb)   09166 Cardiovascular disease    05416 Viral myocarditis     294273 (RT1-DMb)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     294273 (RT1-DMb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rno04147]     294273 (RT1-DMb) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    294273 (RT1-DMb)   Exosomal proteins of epithelial cells    294273 (RT1-DMb)   Exosomal proteins of breast milk    294273 (RT1-DMb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MHC_II_beta C1-set Ig_2 Ig_3 I-set C2-set_3 C2-set_2 Motif Other DBs NCBI-GeneID:  294273 NCBI-ProteinID:  NP_942035 RGD:  735096 Ensembl:  ENSRNOG00000049491 Vega:  OTTRNOG00000001668 UniProt:  Q6MGA7 A0A023ILP6 LinkDB All DBs Position 20:complement(4695009..4702560) Genome browser AA seq 261 aa AA seqDB search MAALWPLLLALSLGCIGAGGFVAHVESTCLLDDEGTPMDFTYCISFNKDLLACWDPEEGQ IVPCEYGVLFKLAEFISNILNKEEGLIQRLKNGLQDCSTHTQPFWNALTHRTRTPSVQVA QTAPFNTREPVMLACYVWGFYPADVTVVWMKNGQLVTSHSNKEKTAQPNGDWTYQTVSYL ALTPSYWDIYTCVVQHSGTPEPIRANWTPGLSPIQTVKVSVSAATLGLGFIIFCLGFFRW RKSHSSSYTPLPGSTYPEGRP NT seq 786 nt NT seq  +upstreamnt  +downstreamnt atggctgcactatggccgctgctgctggccctgagtctgggttgtataggagcaggtggc tttgtggctcatgtggaaagcacgtgcttgctggatgatgaagggaccccaatggacttc acatactgtatttccttcaacaaagatctgctggcctgctgggatccagaggagggacaa atagtcccctgtgaatatggggtcctgtttaagttggccgaattcatttcaaatatcctc aacaaggaagaaggcctgatccagcgcttgaaaaatgggcttcaggactgttccacacac acccagcccttctggaacgcgctgacccacagaaccagaacgccatctgtccaagtagcc caaaccgctccttttaacacaagggagcctgtgatgctggcctgctacgtctggggcttc tatccggcggatgtgaccgtcgtgtggatgaagaacgggcagcttgttacttcccacagc aacaaggagaagacggctcagcctaatggggactggacataccagaccgtctcctaccta gccttaaccccttcctactgggacatctacacctgcgtggtacagcacagcgggacccct gagcccatccgcgcgaactggacacccgggctgtcccccatccagacagtgaaggtctct gtgtctgcagccaccctgggcctgggcttcatcatcttctgtcttggcttcttcagatgg cgcaagtctcactcctccagctacactcctctccctggatccacctacccggaaggacgg ccctag

DBGET integrated database retrieval system