Rattus norvegicus (rat): 294274 Help Entry 294274            CDS       T01003                                  Symbol RT1-DMa Name (RefSeq) RT1 class II, DM alpha precursor   KO K06752   MHC class II antigen Organism rno  Rattus norvegicus (rat) Pathway rno04145   Phagocytosis rno04514   Cell adhesion molecule (CAM) interaction rno04612   Antigen processing and presentation rno04640   Hematopoietic cell lineage rno04658   Th1 and Th2 cell differentiation rno04659   Th17 cell differentiation rno04672   Intestinal immune network for IgA production rno04940   Type I diabetes mellitus rno05140   Leishmaniasis rno05145   Toxoplasmosis rno05150   Staphylococcus aureus infection rno05152   Tuberculosis rno05164   Influenza A rno05166   Human T-cell leukemia virus 1 infection rno05168   Herpes simplex virus 1 infection rno05169   Epstein-Barr virus infection rno05310   Asthma rno05320   Autoimmune thyroid disease rno05321   Inflammatory bowel disease rno05322   Systemic lupus erythematosus rno05323   Rheumatoid arthritis rno05330   Allograft rejection rno05332   Graft-versus-host disease rno05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     294274 (RT1-DMa)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     294274 (RT1-DMa)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     294274 (RT1-DMa)    04612 Antigen processing and presentation     294274 (RT1-DMa)    04658 Th1 and Th2 cell differentiation     294274 (RT1-DMa)    04659 Th17 cell differentiation     294274 (RT1-DMa)    04672 Intestinal immune network for IgA production     294274 (RT1-DMa)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     294274 (RT1-DMa)    05164 Influenza A     294274 (RT1-DMa)    05168 Herpes simplex virus 1 infection     294274 (RT1-DMa)    05169 Epstein-Barr virus infection     294274 (RT1-DMa)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     294274 (RT1-DMa)    05152 Tuberculosis     294274 (RT1-DMa)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     294274 (RT1-DMa)    05140 Leishmaniasis     294274 (RT1-DMa)   09163 Immune disease    05310 Asthma     294274 (RT1-DMa)    05322 Systemic lupus erythematosus     294274 (RT1-DMa)    05323 Rheumatoid arthritis     294274 (RT1-DMa)    05320 Autoimmune thyroid disease     294274 (RT1-DMa)    05321 Inflammatory bowel disease     294274 (RT1-DMa)    05330 Allograft rejection     294274 (RT1-DMa)    05332 Graft-versus-host disease     294274 (RT1-DMa)   09166 Cardiovascular disease    05416 Viral myocarditis     294274 (RT1-DMa)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     294274 (RT1-DMa)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rno04147]     294274 (RT1-DMa) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    294274 (RT1-DMa)   Exosomal proteins of epithelial cells    294274 (RT1-DMa)   Exosomal proteins of breast milk    294274 (RT1-DMa) SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_alpha C1-set Motif Other DBs NCBI-GeneID:  294274 NCBI-ProteinID:  NP_942036 RGD:  735053 Ensembl:  ENSRNOG00000066773 Vega:  OTTRNOG00000001667 UniProt:  Q95574 M0RA07 LinkDB All DBs Position 20:complement(4708932..4712335) Genome browser AA seq 260 aa AA seqDB search MEHEQKSGGLLRLLRLLWLLPHSWAVLEASPQAWWDESQNHTFRHTLFCQDGFPNIGLSE TYDEDALFSFDFSQNTRVPRLPEFAEWAQEQGDASAIAFDKGFCDMLMQNVSPRLEGQIP VSRGLPSAEVFTLKPLEFGKPNTLVCFISNLFPPTLTVTWQHHFVPVEGASPTSVSAIDG LTFQAFSYLNFTPEPFDLYSCTVTHEIDRYTAIAYWVPQNALPSDLLENVLCGVAFGLGV LGLVVGIVFFIRSQRPCSGD NT seq 783 nt NT seq  +upstreamnt  +downstreamnt atggagcatgagcagaagtcaggagggctgctgaggctgctgcggcttctgtggctgctg cctcactcctgggcggtgcttgaagcttctccccaggcgtggtgggatgagtcgcagaac cacacattccgtcacactctgttctgccaggatgggtttcccaacatagggctctccgag acctacgacgaggacgcactcttctccttcgacttctcccagaacaccagagtgccccgg ctgcctgagtttgctgagtgggctcaggaacagggagatgcctctgccattgcgtttgac aaaggcttctgcgacatgttgatgcagaatgtgagcccgcggcttgaaggtcaaatccca gtgtccagaggtttgccttcggctgaggtgttcaccctgaagcccctggagtttggcaag cccaacacgctggtctgtttcatcagcaacctctttccaccgactttgacggtgacctgg cagcatcatttcgtccccgtggagggagccagccccacatccgtttcagccatcgatggg ctcaccttccaggccttctcttatttaaacttcacaccggaacccttcgacctttactcc tgcactgtgacgcacgagattgaccgctacacggcgattgcctattgggtaccccagaac gccctgccttcagatctcctggagaatgtactgtgcggtgtggccttcggcctcggtgtg ctgggcctcgtcgtgggcattgtcttcttcatccgctcccagagaccttgctcaggggac tga

DBGET integrated database retrieval system