KEGG   Rattus norvegicus (rat): 296973
Entry
296973            CDS       T01003                                 

Gene name
Bpgm
Definition
(RefSeq) bisphosphoglycerate mutase
  KO
K01837  bisphosphoglycerate/phosphoglycerate mutase [EC:5.4.2.4 5.4.2.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00260  Glycine, serine and threonine metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    296973 (Bpgm)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    296973 (Bpgm)
Enzymes [BR:rno01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.4  bisphosphoglycerate mutase
     296973 (Bpgm)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     296973 (Bpgm)
SSDB
Motif
Pfam: His_Phos_1
Other DBs
NCBI-GeneID: 296973
NCBI-ProteinID: NP_955414
RGD: 735018
Ensembl: ENSRNOG00000010133
UniProt: Q6P6G4
LinkDB
Position
4
AA seq 258 aa
MSKHRLIILRHGEGQWNKENRFCSWVDQKLNSDGLEEARNCGRQLKALNFEFDLVFTSIL
NRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREKMALNHGEEQVRLWRRSYN
VTPPPIEESHPFFHEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWKERISPEILKG
KTVLISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAIRPHQFLGNQEA
IQAAIKKVDDQGKVRQNK
NT seq 777 nt   +upstreamnt  +downstreamnt
atgtcgaagcacagacttattatactaagacacggagagggccaatggaataaggagaac
cgattctgtagttgggtggaccagaaacttaacagtgacggactggaggaggctcggaac
tgtgggaggcagctcaaagctctcaacttcgagtttgatctcgtcttcacgtccatcctt
aacaggtccattcacacagcctggctgatcctggaagagctggggcaggagtgggttcct
gtggagagctcttggcgtctgaatgagcgtcactatggagccttgattggtctcaacagg
gagaaaatggctttgaatcatggtgaagagcaggtaaggctctggaggagaagctacaac
gtgaccccacctcccattgaggagtctcatcccttcttccatgagatctacaatgaccgg
aggtacaaagtgtgcgacgtgcccttggatcaactgccacgttcagaaagcttgaaggat
gttctggaaagacttcttccctactggaaggaaaggatttctccggaaatcttgaagggc
aaaaccgttctgatatctgctcatgggaatagcagtagagccctcctgaaacatctagaa
ggtatctcagacgaggatatcatcaacatcactctgcccactggagttccgattctgctg
gagttggatgagaacctgcgtgccattaggcctcaccagttcttgggcaaccaggaggcc
atccaggcagccattaagaaagtggatgatcaagggaaagtgagacaaaacaaataa

DBGET integrated database retrieval system