Rattus norvegicus (rat): 304197 Help Entry 304197            CDS       T01003                                  Symbol Cd209l1 Name (RefSeq) CD209 antigen-like protein E   KO K06563   C-type lectin domain family 4 member L/M Organism rno  Rattus norvegicus (rat) Pathway rno03260   Virion - Human immunodeficiency virus rno03264   Virion - Flavivirus and Alphavirus rno03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus rno03273   Virion - Lassa virus and SFTS virus rno04145   Phagosome rno04625   C-type lectin receptor signaling pathway rno05152   Tuberculosis rno05162   Measles Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     304197 (Cd209l1)    03264 Virion - Flavivirus and Alphavirus     304197 (Cd209l1)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     304197 (Cd209l1)    03273 Virion - Lassa virus and SFTS virus     304197 (Cd209l1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     304197 (Cd209l1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     304197 (Cd209l1)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     304197 (Cd209l1)   09171 Infectious disease: bacterial    05152 Tuberculosis     304197 (Cd209l1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rno04131]     304197 (Cd209l1)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:rno04054]     304197 (Cd209l1)    04515 Cell adhesion molecules [BR:rno04515]     304197 (Cd209l1)    04090 CD molecules [BR:rno04090]     304197 (Cd209l1)    04091 Lectins [BR:rno04091]     304197 (Cd209l1) Membrane trafficking [BR:rno04131]  Endocytosis   Phagocytosis    C-lectin receptors     304197 (Cd209l1) Pattern recognition receptors [BR:rno04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    304197 (Cd209l1) Cell adhesion molecules [BR:rno04515]  Lectins   Selectins and C-type lectins    304197 (Cd209l1) CD molecules [BR:rno04090]  Proteins   304197 (Cd209l1) Lectins [BR:rno04091]  C-Type lectins   Asialoglycoprotein and DC receptors    304197 (Cd209l1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lectin_C DUF4083 Motif Other DBs NCBI-GeneID:  304197 NCBI-ProteinID:  XP_221808 RGD:  1564571 LinkDB All DBs Position 12:7156799..7164306 Genome browser AA seq 207 aa AA seqDB search MRVFNRERKKHLHSLGCQDHEYFITVLQLISIVLLAALLTAILVKGSEVPSSQEHDQQKQ RMHQKLDQLKTGLDHLCRPCPWDWTFFQGNCYFFSTFQKKWKESVIACKDMGAQLVVIKS YEEQSFLQRTSKMKGNTWIGLSDSQEEDQWLWVDGSPLQWRNYWSAGEPNNLYDEDCVEF SSYGWNDISCSFEKFWICKKSASPCPR NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgagagtcttcaacagagagaggaagaaacatctgcactccttggggtgtcaggaccat gaatatttcatcactgtgctgcagctcatctccattgtgctcttggctgctctcctcacg gctatccttgtcaaaggctctgaggttcctagttcccaagagcatgatcagcaaaagcaa cgcatgcaccagaaactggaccagctgaagactggactagaccacctgtgccgcccctgc ccctgggactggacgttctttcaaggaaactgttactttttctctactttccaaaagaaa tggaaggaatctgtcattgcctgcaaggacatgggggcccaactagtggtcataaaaagt tatgaggagcagagcttcctccagaggacttctaagatgaaaggcaatacctggataggg ctgtcagactcacaagaggaagaccaatggctgtgggtagatggctcaccactgcagtgg aggaactattggtctgcaggggagcccaacaatttgtacgatgaagactgtgtggaattt tcaagttatggatggaatgatatctcatgttcctttgagaagttctggatctgtaagaag tctgcatctccttgccctaggtga

DBGET integrated database retrieval system