Rattus norvegicus (rat): 309295 Help Entry 309295            CDS       T01003                                  Symbol Ikbkg Name (RefSeq) NF-kappa-B essential modulator   KO K07210   inhibitor of nuclear factor kappa-B kinase subunit gamma Organism rno  Rattus norvegicus (rat) Pathway rno01523   Antifolate resistance rno04010   MAPK signaling pathway rno04014   Ras signaling pathway rno04062   Chemokine signaling pathway rno04064   NF-kappa B signaling pathway rno04151   PI3K-Akt signaling pathway rno04210   Apoptosis rno04380   Osteoclast differentiation rno04620   Toll-like receptor signaling pathway rno04621   NOD-like receptor signaling pathway rno04622   RIG-I-like receptor signaling pathway rno04623   Cytosolic DNA-sensing pathway rno04625   C-type lectin receptor signaling pathway rno04657   IL-17 signaling pathway rno04658   Th1 and Th2 cell differentiation rno04659   Th17 cell differentiation rno04660   T cell receptor signaling pathway rno04662   B cell receptor signaling pathway rno04668   TNF signaling pathway rno04920   Adipocytokine signaling pathway rno04936   Alcoholic liver disease rno05010   Alzheimer disease rno05132   Salmonella infection rno05135   Yersinia infection rno05142   Chagas disease rno05145   Toxoplasmosis rno05160   Hepatitis C rno05161   Hepatitis B rno05162   Measles rno05163   Human cytomegalovirus infection rno05164   Influenza A rno05165   Human papillomavirus infection rno05166   Human T-cell leukemia virus 1 infection rno05167   Kaposi sarcoma-associated herpesvirus infection rno05168   Herpes simplex virus 1 infection rno05169   Epstein-Barr virus infection rno05170   Human immunodeficiency virus 1 infection rno05171   Coronavirus disease - COVID-19 rno05200   Pathways in cancer rno05203   Viral carcinogenesis rno05208   Chemical carcinogenesis - reactive oxygen species rno05212   Pancreatic cancer rno05215   Prostate cancer rno05220   Chronic myeloid leukemia rno05221   Acute myeloid leukemia rno05222   Small cell lung cancer rno05235   PD-L1 expression and PD-1 checkpoint pathway in cancer rno05340   Primary immunodeficiency rno05417   Lipid and atherosclerosis rno05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     309295 (Ikbkg)    04014 Ras signaling pathway     309295 (Ikbkg)    04064 NF-kappa B signaling pathway     309295 (Ikbkg)    04668 TNF signaling pathway     309295 (Ikbkg)    04151 PI3K-Akt signaling pathway     309295 (Ikbkg)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     309295 (Ikbkg)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     309295 (Ikbkg)    04621 NOD-like receptor signaling pathway     309295 (Ikbkg)    04622 RIG-I-like receptor signaling pathway     309295 (Ikbkg)    04623 Cytosolic DNA-sensing pathway     309295 (Ikbkg)    04625 C-type lectin receptor signaling pathway     309295 (Ikbkg)    04660 T cell receptor signaling pathway     309295 (Ikbkg)    04658 Th1 and Th2 cell differentiation     309295 (Ikbkg)    04659 Th17 cell differentiation     309295 (Ikbkg)    04657 IL-17 signaling pathway     309295 (Ikbkg)    04662 B cell receptor signaling pathway     309295 (Ikbkg)    04062 Chemokine signaling pathway     309295 (Ikbkg)   09152 Endocrine system    04920 Adipocytokine signaling pathway     309295 (Ikbkg)   09158 Development and regeneration    04380 Osteoclast differentiation     309295 (Ikbkg)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     309295 (Ikbkg)    05208 Chemical carcinogenesis - reactive oxygen species     309295 (Ikbkg)    05203 Viral carcinogenesis     309295 (Ikbkg)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     309295 (Ikbkg)   09162 Cancer: specific types    05212 Pancreatic cancer     309295 (Ikbkg)    05221 Acute myeloid leukemia     309295 (Ikbkg)    05220 Chronic myeloid leukemia     309295 (Ikbkg)    05215 Prostate cancer     309295 (Ikbkg)    05222 Small cell lung cancer     309295 (Ikbkg)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     309295 (Ikbkg)    05170 Human immunodeficiency virus 1 infection     309295 (Ikbkg)    05161 Hepatitis B     309295 (Ikbkg)    05160 Hepatitis C     309295 (Ikbkg)    05171 Coronavirus disease - COVID-19     309295 (Ikbkg)    05164 Influenza A     309295 (Ikbkg)    05162 Measles     309295 (Ikbkg)    05168 Herpes simplex virus 1 infection     309295 (Ikbkg)    05163 Human cytomegalovirus infection     309295 (Ikbkg)    05167 Kaposi sarcoma-associated herpesvirus infection     309295 (Ikbkg)    05169 Epstein-Barr virus infection     309295 (Ikbkg)    05165 Human papillomavirus infection     309295 (Ikbkg)   09171 Infectious disease: bacterial    05132 Salmonella infection     309295 (Ikbkg)    05135 Yersinia infection     309295 (Ikbkg)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     309295 (Ikbkg)    05142 Chagas disease     309295 (Ikbkg)   09163 Immune disease    05340 Primary immunodeficiency     309295 (Ikbkg)   09164 Neurodegenerative disease    05010 Alzheimer disease     309295 (Ikbkg)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     309295 (Ikbkg)    05418 Fluid shear stress and atherosclerosis     309295 (Ikbkg)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     309295 (Ikbkg)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     309295 (Ikbkg)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:rno01001]     309295 (Ikbkg) Protein kinases [BR:rno01001]  Serine/threonine kinases: Other   IKK family [OT]    309295 (Ikbkg) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NEMO CC2-LZ zf_C2H2_10 HrpB7 Zn_SUZ12 PKC_C2 PAH Nairovirus_NSm Motif Other DBs NCBI-GeneID:  309295 NCBI-ProteinID:  NP_954534 RGD:  735223 Ensembl:  ENSRNOG00000060936 UniProt:  Q6TMG5 LinkDB All DBs Position X:157358279..157397563 Genome browser AA seq 412 aa AA seqDB search MSRHLWKNQLSEMVQPSGGPAEDQDMLGEESSLGKPAMLHLPSEQGTPETLQRCLEENQE LRDAIRQSNQMLRERCEELLHFQVSQREEKEFLMCKFQEARKLVERLSLEKLDLRRQREQ ALEDLEHLKKCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQTLEGRIRAVSEQ VRQLESEREVLQQQHSVQVDQLRMQNQSVEAALRMERQAASEEKRKLAQLQAAYHQLFQD YDSHIKSSKGMQLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADI YKADFQAERHAREKLVERKELLQEQLEQLQREFNKLKVGCHESARIEDMRKRHVETSQPP LLPAPAHHSFHLALSNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt atgagcaggcacctctggaagaatcagttgagtgagatggtgcaacccagtggtggccca gcagaggaccaggacatgctgggtgaagaatcttctctggggaagccagcaatgctacat cttccttcagagcagggtactcctgagaccctccagcgctgtctggaagagaatcaagaa ctccgagatgctatccggcagagcaatcagatgctgagggaacgctgtgaggagctgctg catttccaggtcagccagcgggaggagaaggagttcctcatgtgcaaattccaggaagcc aggaagctggtggagagactgagcttggagaagcttgacctgcggaggcagagagaacag gccttagaggatttggagcatctgaagaaatgccaacagcagatggctgaggacaaggcc tctgtgaaagctcaggtgacatcattgctgggggaactccaggagagccagagtcgtttg gaggctgctaccaaggaacgacaaactttagagggaaggattcgagcagttagtgagcag gtcagacagctggagagtgagcgggaggtgctgcagcagcagcacagtgtccaggtggac caactgcgcatgcagaaccagagtgtggaggctgccttgcgaatggagcgacaggctgct tcagaggagaagcggaagctggctcagttgcaggcagcctatcaccaactcttccaagac tatgacagccacattaagagcagcaagggcatgcagctggaagatctgaggcagcagctc cagcaagctgaggaggccctggtagccaaacaggaattgattgataagctgaaagaggaa gctgagcagcacaagattgtcatggagaccgttccagtcttgaaagcccaggcggacatc tacaaggctgacttccaagctgagaggcatgcccgggagaaactggtggagaggaaggag cttttgcaggagcagttggagcagctgcagcgcgagttcaacaagttgaaagttggctgc catgagtcagccaggattgaggatatgaggaagcggcatgtagagacttcccagccccct ttactccctgctccagctcaccactcctttcatttggccttgtccaaccagcggaggagc cctcctgaggaaccacctgacttctgttgtcccaagtgccagtatcaggctcctgatatg gacactctacagatacatgtcatggagtgcatagagtag

DBGET integrated database retrieval system