Rattus norvegicus (rat): 311359 Help Entry 311359            CDS       T01003                                  Symbol Hypk Name (RefSeq) huntingtin-interacting protein K   KO K28128   huntingtin-interacting protein K Organism rno  Rattus norvegicus (rat) Brite KEGG Orthology (KO) [BR:rno00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:rno03110]     311359 (Hypk)    03036 Chromosome and associated proteins [BR:rno03036]     311359 (Hypk) Chaperones and folding catalysts [BR:rno03110]  Other chaperones and cochaperones   Others    311359 (Hypk) Chromosome and associated proteins [BR:rno03036]  Eukaryotic type   Sister chromatid cohesion proteins    Other sister chromatid cohesion factors     311359 (Hypk) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  UBA_HYPK UBA_7 SPT6_acidic Motif Other DBs NCBI-GeneID:  311359 NCBI-ProteinID:  NP_001292192 RGD:  1311457 Ensembl:  ENSRNOG00000065122 UniProt:  A6HPP9 LinkDB All DBs Position 3:128888709..128890089 Genome browser AA seq 121 aa AA seqDB search MATEGDVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETAMSVIG DRRSREQKAKQEREKELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNVVEALIALT N NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggcgaccgagggagacgtggagctcgagttagagactgagaccagcggccctgagcgg cctcccgagaagccaaggaaacatgacagtggtgctgctgacctagagcgggttactgac tatgcggaggagaaagagatccagagttcgaatcttgagacggctatgtccgtcattgga gacagacggtccagggagcaaaaggccaaacaggagcgggagaaggaactggcgaaggtc actatcaagaaggaagatctggagttgataatgacagaaatggagatctctcgagcagca gccgaaaggagcttgagggaacacatgggcaatgtggtggaggctcttattgccctaacc aactga

DBGET integrated database retrieval system