Rattus norvegicus (rat): 314322 Help Entry 314322            CDS       T01003                                  Symbol Fos Name (RefSeq) protein c-Fos   KO K04379   proto-oncogene protein c-fos Organism rno  Rattus norvegicus (rat) Pathway rno01522   Endocrine resistance rno04010   MAPK signaling pathway rno04024   cAMP signaling pathway rno04210   Apoptosis rno04380   Osteoclast differentiation rno04620   Toll-like receptor signaling pathway rno04657   IL-17 signaling pathway rno04658   Th1 and Th2 cell differentiation rno04659   Th17 cell differentiation rno04660   T cell receptor signaling pathway rno04662   B cell receptor signaling pathway rno04668   TNF signaling pathway rno04713   Circadian entrainment rno04725   Cholinergic synapse rno04728   Dopaminergic synapse rno04915   Estrogen signaling pathway rno04917   Prolactin signaling pathway rno04921   Oxytocin signaling pathway rno04926   Relaxin signaling pathway rno04928   Parathyroid hormone synthesis, secretion and action rno04932   Non-alcoholic fatty liver disease rno04935   Growth hormone synthesis, secretion and action rno05031   Amphetamine addiction rno05132   Salmonella infection rno05133   Pertussis rno05135   Yersinia infection rno05140   Leishmaniasis rno05142   Chagas disease rno05161   Hepatitis B rno05162   Measles rno05166   Human T-cell leukemia virus 1 infection rno05167   Kaposi sarcoma-associated herpesvirus infection rno05170   Human immunodeficiency virus 1 infection rno05171   Coronavirus disease - COVID-19 rno05200   Pathways in cancer rno05207   Chemical carcinogenesis - receptor activation rno05208   Chemical carcinogenesis - reactive oxygen species rno05210   Colorectal cancer rno05224   Breast cancer rno05231   Choline metabolism in cancer rno05235   PD-L1 expression and PD-1 checkpoint pathway in cancer rno05323   Rheumatoid arthritis rno05417   Lipid and atherosclerosis rno05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     314322 (Fos)    04668 TNF signaling pathway     314322 (Fos)    04024 cAMP signaling pathway     314322 (Fos)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     314322 (Fos)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     314322 (Fos)    04660 T cell receptor signaling pathway     314322 (Fos)    04658 Th1 and Th2 cell differentiation     314322 (Fos)    04659 Th17 cell differentiation     314322 (Fos)    04657 IL-17 signaling pathway     314322 (Fos)    04662 B cell receptor signaling pathway     314322 (Fos)   09152 Endocrine system    04915 Estrogen signaling pathway     314322 (Fos)    04917 Prolactin signaling pathway     314322 (Fos)    04921 Oxytocin signaling pathway     314322 (Fos)    04926 Relaxin signaling pathway     314322 (Fos)    04935 Growth hormone synthesis, secretion and action     314322 (Fos)    04928 Parathyroid hormone synthesis, secretion and action     314322 (Fos)   09156 Nervous system    04725 Cholinergic synapse     314322 (Fos)    04728 Dopaminergic synapse     314322 (Fos)   09158 Development and regeneration    04380 Osteoclast differentiation     314322 (Fos)   09159 Environmental adaptation    04713 Circadian entrainment     314322 (Fos)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     314322 (Fos)    05207 Chemical carcinogenesis - receptor activation     314322 (Fos)    05208 Chemical carcinogenesis - reactive oxygen species     314322 (Fos)    05231 Choline metabolism in cancer     314322 (Fos)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     314322 (Fos)   09162 Cancer: specific types    05210 Colorectal cancer     314322 (Fos)    05224 Breast cancer     314322 (Fos)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     314322 (Fos)    05170 Human immunodeficiency virus 1 infection     314322 (Fos)    05161 Hepatitis B     314322 (Fos)    05171 Coronavirus disease - COVID-19     314322 (Fos)    05162 Measles     314322 (Fos)    05167 Kaposi sarcoma-associated herpesvirus infection     314322 (Fos)   09171 Infectious disease: bacterial    05132 Salmonella infection     314322 (Fos)    05135 Yersinia infection     314322 (Fos)    05133 Pertussis     314322 (Fos)   09174 Infectious disease: parasitic    05140 Leishmaniasis     314322 (Fos)    05142 Chagas disease     314322 (Fos)   09163 Immune disease    05323 Rheumatoid arthritis     314322 (Fos)   09165 Substance dependence    05031 Amphetamine addiction     314322 (Fos)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     314322 (Fos)    05418 Fluid shear stress and atherosclerosis     314322 (Fos)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     314322 (Fos)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     314322 (Fos)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:rno03000]     314322 (Fos)    04131 Membrane trafficking [BR:rno04131]     314322 (Fos) Transcription factors [BR:rno03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     314322 (Fos) Membrane trafficking [BR:rno04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     314322 (Fos) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  314322 NCBI-ProteinID:  NP_071533 RGD:  2626 Ensembl:  ENSRNOG00000008015 UniProt:  P12841 A6JE29 LinkDB All DBs Position 6:110852188..110855054 Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTPSTGAYARAGVVKTMSGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPNDLGFPEEMSVTSLDLTGGLPEATTPESEEAFT LPLLNDPEPKPSLEPVKNISNMELKAEPFDDFLFPASSRPSGSETARSVPDVDLSGSFYA ADWEPLHSSSLGMGPMVTELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctcgggtttcaacgcggactacgaggcgtcatcctcccgctgcagtagcgcc tccccggccggggacagcctttcctactaccattccccagccgactccttctccagcatg ggctcccctgtcaacacacaggacttttgcgcagatctgtccgtctctagtgccaacttt atccccacggtgacagccatctccaccagcccagacctgcagtggctggtgcagcccact ctggtctcctccgtggccccatcgcagaccagagcgccccatccttacggactccccacc ccgtcgaccggggcttacgccagagcgggagtggtgaagaccatgtcaggcggcagagcg cagagcatcggcagaaggggcaaagtagagcagctatctcctgaagaggaagagaaacgg agaatccgaagggaaaggaataagatggctgcagccaagtgccggaatcggaggagggag ctgacagatacgctccaagcggagacagatcaacttgaagacgagaagtctgcgttgcag accgagattgccaatctactgaaagagaaggaaaaactggagtttattttggcagcccac cgacctgcctgcaagatccccaatgacctgggcttcccagaggagatgtctgtgacctcc ctggacttgactgggggtctgcctgaggctaccaccccagagtctgaggaggccttcacc ctgcctcttctcaatgaccctgagcccaagccatccttggagccggtcaagaacattagc aacatggagctgaaggctgaaccctttgatgacttcttgtttccggcatcatctaggccc agtggctcggagactgcccgctctgtgccagatgtggacctgtctggttccttctatgca gcagactgggagcctctgcacagcagttccctggggatggggcccatggtcacagagctg gagcccctgtgcactcccgttgtcacctgcactcccagctgcactacctatacgtcttcc tttgtcttcacctaccccgaggctgactccttccctagctgcgcagctgcccaccgaaag ggcagcagcagcaacgagccctcctctgactcactgagctcgcccacactgctagccctg tga

DBGET integrated database retrieval system