KEGG   Rattus norvegicus (rat): 362788
Entry
362788            CDS       T01003                                 
Symbol
Traf3
Name
(RefSeq) TNF receptor-associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno04936  Alcoholic liver disease
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05222  Small cell lung cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    362788 (Traf3)
   04668 TNF signaling pathway
    362788 (Traf3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    362788 (Traf3)
   04621 NOD-like receptor signaling pathway
    362788 (Traf3)
   04622 RIG-I-like receptor signaling pathway
    362788 (Traf3)
   04657 IL-17 signaling pathway
    362788 (Traf3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    362788 (Traf3)
   05203 Viral carcinogenesis
    362788 (Traf3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    362788 (Traf3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    362788 (Traf3)
   05160 Hepatitis C
    362788 (Traf3)
   05171 Coronavirus disease - COVID-19
    362788 (Traf3)
   05164 Influenza A
    362788 (Traf3)
   05162 Measles
    362788 (Traf3)
   05168 Herpes simplex virus 1 infection
    362788 (Traf3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    362788 (Traf3)
   05169 Epstein-Barr virus infection
    362788 (Traf3)
   05165 Human papillomavirus infection
    362788 (Traf3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    362788 (Traf3)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    362788 (Traf3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 MPS2 Cast Spc29 zf-RING_UBOX Tropomyosin_1 ATG16 KxDL Crescentin GAS FliJ DUF1664 T3SSipB BLOC1_2 Exonuc_VII_L SPATA24
Other DBs
NCBI-GeneID: 362788
NCBI-ProteinID: NP_001102194
RGD: 1304633
Ensembl: ENSRNOG00000008145
UniProt: D3Z9G0
LinkDB
Position
6:130199696..130307168
AA seq 567 aa
MEPSKKMGAAGAAQPNPPLKLQPDRGAASVLVPEQGGYKEKFAKTVEDKYKCEKCRLVLC
NPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQIYCRNEG
RGCVEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRRDLRDHVEKACKYREATCAHCK
SQVPMITLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVF
QGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIE
IERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRV
TELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWK
IRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGE
YDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQT
VLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggagccaagcaagaagatgggtgctgctggcgcagcgcagcccaacccacccctcaag
ctgcagcccgatcgcggcgcagcgtcagtgctcgtgccggagcaaggaggctacaaggag
aagttcgcgaagacagtggaggacaagtacaagtgcgagaagtgccgcctggtgctgtgc
aacccgaagcagacggagtgtgggcaccgcttctgtgagagctgcatggccgccctgctg
agctcctcaagtccaaaatgcacagcctgccaagaaagcatcatcaaagacaaggtgttc
aaggataattgctgcaagagagagatcctggcccttcagatctactgtcggaacgaaggc
agaggctgcgtggagcagctgactctgggacatctgctggtgcacctgaaaaacgagtgt
cagtttgaggaactcccctgcctgcgtgccgactgcaaagagaaagtactgaggagagac
ttgcgggatcacgtggaaaaggcctgtaaataccgagaggccacgtgcgcccactgcaag
agccaagtccccatgatcacactgcagaaacatgaagacacggattgtccctgtgtggtg
gtgtcctgccctcataagtgcagcgttcagactcttctgaggagtgagttgagtgcacac
ttgtccgagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgttttt
cagggtacaaaccagcagatcaaggcccacgaggccagctccgcggtccagcacgtgaac
ctgctgaaggagtggagcaactccctggagaagaaggtttccttgctgcagaatgaaagt
gttgagaaaaacaagagcatacaaagtctgcacaaccagatatgtagctttgagattgaa
attgagagacaaaaggagatgcttcgaaacaatgagtccaaaatccttcatttgcagcga
gtaatagacagccaagcagagaaactgaaagaactcgacaaggagatccgtcccttccgg
cagaactgggaggaagcagacagcatgaagagcagtgtggaatccctccagaaccgtgtg
actgagctagaaagcgtagacaaaagtgcagggcaggcagctcgcaacacaggcttgctg
gagtcccagctgagccggcatgaccagatgctgagtgtccacgacatccgcttggccgac
atggacctgcgcttccaggtcctcgagactgccagctacaatggtgtgctaatctggaag
atccgtgactacaagcgccggaagcaggaggctgtcatggggaagaccctatctctctac
agccagcctttctacacaggttattttggctataagatgtgtgcccgggtctacctgaac
ggggacggaatggggaaagggacacacttgtcgctgttttttgtcattatgcgcggagaa
tatgatgctctgttgccgtggccattcaagcagaaagtgacacttatgctgatggatcag
gggtcctctcgacgccatctgggagatgcgttcaagcctgatcccaacagcagcagcttc
aagaagcccacgggagagatgaacatcgcctctggctgcccagtctttgtcgcccaaact
gttctcgagaacgggacgtacattaaagatgatacaatttttattaaagtcatagtggat
acctcggatctgcctgacccctga

DBGET integrated database retrieval system