Rattus norvegicus (rat): 363856 Help Entry 363856            CDS       T01003                                  Symbol Cd209d Name (RefSeq) CD209d molecule   KO K06563   C-type lectin domain family 4 member L/M Organism rno  Rattus norvegicus (rat) Pathway rno03260   Virion - Human immunodeficiency virus rno03264   Virion - Flavivirus and Alphavirus rno03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus rno03273   Virion - Lassa virus and SFTS virus rno04145   Phagosome rno04625   C-type lectin receptor signaling pathway rno05152   Tuberculosis rno05162   Measles Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     363856 (Cd209d)    03264 Virion - Flavivirus and Alphavirus     363856 (Cd209d)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     363856 (Cd209d)    03273 Virion - Lassa virus and SFTS virus     363856 (Cd209d)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     363856 (Cd209d)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     363856 (Cd209d)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     363856 (Cd209d)   09171 Infectious disease: bacterial    05152 Tuberculosis     363856 (Cd209d)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rno04131]     363856 (Cd209d)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:rno04054]     363856 (Cd209d)    04515 Cell adhesion molecules [BR:rno04515]     363856 (Cd209d)    04090 CD molecules [BR:rno04090]     363856 (Cd209d)    04091 Lectins [BR:rno04091]     363856 (Cd209d) Membrane trafficking [BR:rno04131]  Endocytosis   Phagocytosis    C-lectin receptors     363856 (Cd209d) Pattern recognition receptors [BR:rno04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    363856 (Cd209d) Cell adhesion molecules [BR:rno04515]  Lectins   Selectins and C-type lectins    363856 (Cd209d) CD molecules [BR:rno04090]  Proteins   363856 (Cd209d) Lectins [BR:rno04091]  C-Type lectins   Asialoglycoprotein and DC receptors    363856 (Cd209d) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lectin_C UL45 Motif Other DBs NCBI-GeneID:  363856 NCBI-ProteinID:  NP_001102319 RGD:  1561104 Ensembl:  ENSRNOG00000001017 UniProt:  A6KQ43 LinkDB All DBs Position 12:complement(6689002..6695452) Genome browser AA seq 237 aa AA seqDB search MSESMESNTQQLDNPEDEEYLMSGSRYSIISSRLRTKFGIKSLAEYTKQSHNPLVLPLLS FLFLAGLLLIILVLVSKVPSSEVQDKIYQELMQLKTEVHDGLCQPCPRDWTFFNGSCYFF SKSQRNWHNSITACKELGAQLVIVETDEEQTFLQQTSKTRGPTWMGLSDMHNEATWHWVD GSPLSPSFAQYWNRGEPNNVGDEDCAEFSGDGWNDLRCDTRIFWICKKVSTSSCTIK NT seq 714 nt NT seq  +upstreamnt  +downstreamnt atgagtgagtccatggaatcaaacacacagcaactggacaatccagaggatgaagagtat ttgatgagtggttccaggtattctattatcagctctcgattacgaacaaaatttggaatc aaaagtttggcagaatatacgaagcagagccacaaccccttggtcctaccgctgctctcc ttcctgttcttggctggccttctgctgatcattcttgtcctagtctcaaaggtacccagc tcagaagttcaggacaaaatctaccaggagctcatgcaactgaagactgaagtccatgat ggcttgtgtcaaccctgtccgagggattggacattcttcaatggaagctgttacttcttc tccaagtcccaaagaaactggcacaactccatcactgcctgcaaggaactgggggctcaa ttggtcatcgtagagacggatgaagagcagaccttcctgcagcagacttctaagactagg ggaccaacatggatgggtctctcagacatgcataatgaagccacgtggcactgggtggat ggctcacctctgtcacccagctttgcacagtattggaatagaggggagcccaacaatgtc ggtgatgaggattgtgcagagttctctggggacggctggaatgacctcagatgcgatacc cggattttctggatctgtaagaaagtttcaacctcatcatgtaccatcaaatga

DBGET integrated database retrieval system