KEGG   Rattus norvegicus (rat): 363984
Entry
363984            CDS       T01003                                 
Symbol
Ikbke
Name
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit epsilon
  KO
K07211  inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04936  Alcoholic liver disease
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
rno05207  Chemical carcinogenesis - receptor activation
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    363984 (Ikbke)
   04621 NOD-like receptor signaling pathway
    363984 (Ikbke)
   04622 RIG-I-like receptor signaling pathway
    363984 (Ikbke)
   04623 Cytosolic DNA-sensing pathway
    363984 (Ikbke)
   04625 C-type lectin receptor signaling pathway
    363984 (Ikbke)
   04657 IL-17 signaling pathway
    363984 (Ikbke)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    363984 (Ikbke)
  09172 Infectious disease: viral
   05161 Hepatitis B
    363984 (Ikbke)
   05160 Hepatitis C
    363984 (Ikbke)
   05171 Coronavirus disease - COVID-19
    363984 (Ikbke)
   05164 Influenza A
    363984 (Ikbke)
   05162 Measles
    363984 (Ikbke)
   05168 Herpes simplex virus 1 infection
    363984 (Ikbke)
   05167 Kaposi sarcoma-associated herpesvirus infection
    363984 (Ikbke)
   05169 Epstein-Barr virus infection
    363984 (Ikbke)
   05165 Human papillomavirus infection
    363984 (Ikbke)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    363984 (Ikbke)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    363984 (Ikbke)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    363984 (Ikbke)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     363984 (Ikbke)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   363984 (Ikbke)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr ABC1 Pkinase_fungal Kinase-like zf-RING_9 DUF2878
Other DBs
NCBI-GeneID: 363984
NCBI-ProteinID: NP_001102324
RGD: 1308352
Ensembl: ENSRNOG00000025100
UniProt: D4A5E7
LinkDB
Position
13:complement(42712154..42738470)
AA seq 717 aa
MQSTTNYLWHTDDLLGQGATANVYKARNKKSGEVVAVKVFNSASYRRPPEVQVREFEVLR
RLDHENIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLEDPENTFGLPEEEFLVVLRCVV
AGMNHLRENGIVHRDIKPGNIMRLVGKEGQSIYKLSDFGAARKLDDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTE
KPAGAISGTQKQENGPLEWSYSLPITCRLSVGLQSQLVPILANILEAEQAKCWGFDQFFA
ETSDILQRTVIHVFSLPQAVLHHIYIHAHNTIAIFLEAVYEQTNVAPKHQEYFFEGHPCV
LEPSLSAQHIAHTAASSPLTLFSMASDTPKGLAFRDPALDVPKFVPKVDLQADYSTAKGV
LGAGYQALWLARVLLDGQALMLRGLHWVLVVLQNTCQQTLEITRTALLFLSSSLGTERLS
SGAGMLDIQELKEATELRSRLQTFSEVLSKCSHNVTETQRSLSCLVGELLKSRDQIHEDN
RSIQKIQCCLDKMHFIYKQFKKSRMRPGLSYNEEQIHKLDKVNFSHLAKRLLQVFQEECA
QTYQVSLVTHGKRMRQVQKAQNHLHLIGHSVATCNSEARGAQESLAKMFDQLLLDRASKQ
GAEVSPQPMATHPGPDPKDLVFHMQELCNDMKLLAFDLQDNNRLIERLHRVPPTPEV
NT seq 2154 nt   +upstreamnt  +downstreamnt
atgcagagtaccactaactacctgtggcatactgatgacctgctagggcagggggccact
gccaatgtgtacaaggcccggaataagaaatccggggaggtggttgctgtaaaggtcttc
aactcagccagctaccggcggccccctgaggtacaagtgagggagttcgaggtcttgcgg
aggctggatcatgagaacatcgtgaagctattcgcagtggaggaaacgggaggcagccgg
cagaaggtgctagtgatggagtactgctccagtgggagcctgctgagcgtgctggaagac
cctgagaacacattcggccttcctgaggaggagttcctggtggtactgcgctgtgtggtg
gctggcatgaaccacctgcgggagaatggcattgtccaccgtgacatcaagcccgggaat
atcatgcgcctggtaggcaaggaggggcagagcatctacaagctgtctgacttcggggct
gcccggaagctggacgacgatgagaagtttgtttctgtctatggtacagaggagtacctg
caccctgacatgtatgagcgggcagtgcttcgcaaaccccagcaaaaggcgttcggggtg
acagtggatctctggagtattggggtgaccttgtaccacgcagccaccggtagtctgccc
ttcatcccctttggtgggccccggcgcaacaaggagatcatgtataggatcaccacagag
aagccagctggggccatttccgggactcagaagcaggaaaatggtcccctggaatggagc
tacagcctccccatcacctgtagactgtctgtggggctgcagagtcagctagtgcccatc
ctggccaacatcctggaggccgaacaggctaaatgctggggcttcgatcagttctttgca
gagaccagtgacatcctgcagcgaactgtcatccatgtcttctccctgccccaggcggtt
ttgcatcacatctacatccatgcccacaacacgattgccatctttttggaggctgtatat
gaacagaccaacgtggcccccaaacaccaagaatacttcttcgagggtcacccttgtgtc
ctcgagccaagcctctcagcccagcacatcgcccacacagctgccagcagccctctaact
ctgttcagcatggccagcgacacacccaaggggctggccttcagggaccctgctctggat
gtcccaaagttcgtccctaaggttgacctacaggccgattacagcaccgctaagggcgtg
ctgggcgctggttaccaggccttgtggctggcgcgggtcctgctggatggacaggcgttg
atgcttcgagggttacactgggtcctggtggtgcttcagaacacgtgccaacagacactg
gagatcacacggacagccctcctcttcctcagtagcagcctgggcactgaaaggctcagc
agtggagctgggatgcttgacatccaggaactaaaggaagccacggagctgaggtccagg
ctgcagactttctcagaggtcctgtctaagtgttcccacaatgtcacagaaacccaaagg
agcctgagttgtctggttggagagcttttgaagagccgggatcagattcatgaggataac
agaagtatccagaagattcagtgttgtttggacaagatgcacttcatctacaaacagttc
aagaagtctaggatgaggccaggcctcagctacaatgaggagcagatccacaagctggat
aaggtaaattttagtcacctagccaagaggctgctgcaggtgttccaggaggagtgtgca
cagacgtatcaggtgtcactggtcacacatggcaagcggatgaggcaggtgcagaaggcc
cagaaccacctgcacctcattggccactccgtggctacctgtaactcagaagcccgggga
gcccaggagagcctggccaagatgtttgatcagctcctcctggacagagcttccaaacag
ggagctgaggtctcaccacaacctatggcaactcatcccggccccgatccgaaggacctg
gtcttccacatgcaggaactttgtaatgatatgaagctattggcctttgatctccaggac
aacaacagactcatcgaacggctacatagagttccaccaacaccagaagtctga

DBGET integrated database retrieval system