KEGG   Rattus norvegicus (rat): 366949
Entry
366949            CDS       T01003                                 

Gene name
Mafa
Definition
(RefSeq) transcription factor MafA
  KO
K07595  transcription factor MAFA
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04930  Type II diabetes mellitus
rno04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    366949 (Mafa)
   04950 Maturity onset diabetes of the young
    366949 (Mafa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    366949 (Mafa)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Maf
    366949 (Mafa)
SSDB
Motif
Pfam: bZIP_Maf Maf_N bZIP_1 KASH_CCD FapA
Other DBs
NCBI-GeneID: 366949
NCBI-ProteinID: XP_006241965
RGD: 1562627
Ensembl: ENSRNOG00000007668
Vega: OTTRNOG00000000273
UniProt: D3ZNT6
LinkDB
Position
7
AA seq 361 aa
MAAELAMGAELPSSPLAIEYVNDFDLMKFEVKKEPPEAERFCHRLPPGSLSSTPLSTPCS
SVPSSPSFCAPSPGTGSSAGGGGSAAQAGGAPGPPSGGPGTVGGASGKAVLEDLYWMSGY
QHHLNPEALNLTPEDAVEALIGSGHHSAHHGAHHPAAAAAYEAFRGQSFAGGGGGGADDM
GAGHHHGAHHTAHHHHSAHHHHHHHHHHGGSGHHGGGAGHGGGGAGHHVRLEERFSDDQL
VSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQ
VEQLKLEVGRLAKERDLYKEKYEKLAGRGGPGGAGGAGFPREPSPAQAGPGAAKGAPDFF
L
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggccgcggagctggcgatgggcgcagagctgcctagcagcccactggccatcgagtac
gtcaacgacttcgacctgatgaagttcgaggtgaagaaggagccgcccgaggccgagcgc
ttctgccaccgcctgccacccggctcgctatcctcgacgcccctcagcacgccctgctcc
tcggtgccctcttcgcccagcttctgcgcacccagccccggcaccggcagcagcgcgggc
ggcgggggtagcgcggctcaggccgggggcgccccggggccgccgagtggaggccccggc
actgtcgggggcgcctcaggaaaagcggtgctggaggatctgtactggatgagcgggtat
cagcaccacctgaaccccgaggcgctcaacctgacgccggaggacgcggtggaggcgctc
atcggcagcggccaccacagcgcgcaccacggcgcgcatcacccagcggctgctgcggcc
tatgaggccttccggggccagagcttcgcgggcggcggcggcggcggcgcggacgacatg
ggtgccggccaccaccacggcgcacaccacactgcacaccaccaccactctgcccaccat
caccatcatcaccaccaccaccacggaggctctggccaccacggtggaggcgcgggtcac
ggtggaggcggcgcgggccaccacgtgcgcttggaggagcgcttctccgacgaccagctg
gtgtccatgtcagtgcgggagctgaaccggcagctccgcggcttcagcaaggaggaggtc
atccgactgaaacagaagcggcgcacgctcaagaaccgcggctacgcgcagtcgtgccgc
ttcaagcgggtgcagcagcggcacattctggagagcgagaagtgccagctccagagccag
gtggagcagctgaagctggaggtggggcgtttggccaaggagcgggacctgtacaaggag
aaatacgagaagttggcgggccggggcgggccggggggcgcgggcggggccggcttccct
cgggagccctcgccagcgcaggctggccccggggcagccaaaggcgcacccgacttcttt
ctgtga

DBGET integrated database retrieval system