Rattus norvegicus (rat): 501797 Help Entry 501797            CDS       T01003                                  Symbol Cd209e Name (RefSeq) CD209 antigen-like protein E   KO K06563   C-type lectin domain family 4 member L/M Organism rno  Rattus norvegicus (rat) Pathway rno03260   Virion - Human immunodeficiency virus rno03264   Virion - Flavivirus and Alphavirus rno03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus rno03273   Virion - Lassa virus and SFTS virus rno04145   Phagosome rno04625   C-type lectin receptor signaling pathway rno05152   Tuberculosis rno05162   Measles Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     501797 (Cd209e)    03264 Virion - Flavivirus and Alphavirus     501797 (Cd209e)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     501797 (Cd209e)    03273 Virion - Lassa virus and SFTS virus     501797 (Cd209e)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     501797 (Cd209e)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     501797 (Cd209e)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     501797 (Cd209e)   09171 Infectious disease: bacterial    05152 Tuberculosis     501797 (Cd209e)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rno04131]     501797 (Cd209e)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:rno04054]     501797 (Cd209e)    04090 CD molecules [BR:rno04090]     501797 (Cd209e)    04091 Lectins [BR:rno04091]     501797 (Cd209e) Membrane trafficking [BR:rno04131]  Endocytosis   Phagocytosis    C-lectin receptors     501797 (Cd209e) Pattern recognition receptors [BR:rno04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    501797 (Cd209e) CD molecules [BR:rno04090]  Proteins   501797 (Cd209e) Lectins [BR:rno04091]  C-Type lectins   Asialoglycoprotein and DC receptors    501797 (Cd209e) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  501797 NCBI-ProteinID:  NP_001178934 RGD:  1563333 Ensembl:  ENSRNOG00000028803 UniProt:  D3ZCF3 A6KQ42 LinkDB All DBs Position 12:complement(6661179..6666634) Genome browser AA seq 207 aa AA seqDB search MRIQQMGSLGFLDRSNIPLVLQLLFLILFAGLLVAIVIQVSKIPSSEEVQWEQTKQEKMY QDLSQLKSEIDSLCRLCPWDWTFFNGNCYFFSKSQRDWHNSITACQEMEAQLVTIKSPEE QSFLQQTSKKNGYTWMGLSDLNKEGEWYWLDGSPLSDSLRNYWNEGQPNNIDGQDCVEFR NDGWNDAKCDNWKFWICKKTATTCSSK NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgaggatacagcagatgggctctctgggatttctagaccggagcaacattcccttggtg ctgcagctgctgttcctcattctctttgctggactcctggtggccattgtcatccaagtt tccaagatccccagctcagaagaagttcagtgggaacagacaaagcaagagaaaatgtac caggacctaagccaactgaagtctgaaattgatagcctctgccgcctctgcccttgggat tggacattcttcaatggaaactgttactttttctccaagtcacaacgggactggcacaac tccatcactgcctgccaagaaatggaggcccaactagtcaccatcaaaagtcccgaggag cagagcttcctacagcagacttccaagaaaaatggctacacctggatggggctgtcagat ctgaacaaggaaggcgagtggtactggctggatgggtcacctctgtcagacagcctcagg aactattggaatgaaggacagcccaataatattgatggacaagactgtgtggaattcaga aatgatggctggaatgatgccaaatgcgacaattggaaattctggatctgcaaaaaaact gcaactacctgttccagcaagtga

DBGET integrated database retrieval system