Rattus norvegicus (rat): 502595 Help Entry 502595            CDS       T01003                                  Symbol Tmem258l1 Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism rno  Rattus norvegicus (rat) Pathway rno00510   N-Glycan biosynthesis rno00513   Various types of N-glycan biosynthesis rno04141   Protein processing in endoplasmic reticulum Module rno_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:rno00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     502595 (Tmem258l1)    00513 Various types of N-glycan biosynthesis     502595 (Tmem258l1)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     502595 (Tmem258l1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 Motif Other DBs NCBI-GeneID:  502595 NCBI-ProteinID:  XP_038959992 RGD:  1565088 LinkDB All DBs Position 2:complement(219117723..219118059) Genome browser AA seq 79 aa AA seqDB search MELEVMGTHTSPVNPAVFPHLTAVLLAIGMFFTSWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLPLWVSVCV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaggtcatgggtacgcataccagcccagtgaacccggctgtcttccctcac ctgactgcggtacttctggccatcggcatgttcttcacctcctggttcttcgtttacgag gtcacctctaccaagtacacgcgcgatatttacaaagagctcctcatctccttggtggcc tcactcttcatgggcttcggagtcctcttcctcccgctctgggttagcgtctgcgtatga

DBGET integrated database retrieval system