Rattus norvegicus (rat): 60661 Help Entry 60661             CDS       T01003                                  Symbol Max Name (RefSeq) protein max isoform 1   KO K04453   Max protein Organism rno  Rattus norvegicus (rat) Pathway rno03083   Polycomb repressive complex rno04010   MAPK signaling pathway rno05200   Pathways in cancer rno05202   Transcriptional misregulation in cancer rno05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     60661 (Max)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     60661 (Max)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     60661 (Max)    05202 Transcriptional misregulation in cancer     60661 (Max)   09162 Cancer: specific types    05222 Small cell lung cancer     60661 (Max)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:rno03000]     60661 (Max)    03036 Chromosome and associated proteins [BR:rno03036]     60661 (Max) Transcription factors [BR:rno03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     60661 (Max) Chromosome and associated proteins [BR:rno03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      60661 (Max) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HLH JetA Filament bZIP_2 bHLH_INO4 SlyX bHLH_INO2 DUF7801 SLX9 GAGA_bind ATG16 DUF4763 XhlA Csm1_N Motif Other DBs NCBI-GeneID:  60661 NCBI-ProteinID:  NP_071546 RGD:  621101 Ensembl:  ENSRNOG00000008049 UniProt:  P52164 A6HCC6 LinkDB All DBs Position 6:complement(101369989..101395333) Genome browser AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN SLYTNAKGGTISAFDGGSDSSSESEPEEPQNRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcaccataatgcactggaacgaaaacgtagggaccacatcaaa gacagctttcacagtttgcgggactcagtcccatcactccaaggagagaaggcatcccgg gcccaaatcctagacaaagcaacagagtatatccagtatatgcgaaggaaaaaccatacg caccagcaagacattgatgacctcaagcggcagaatgctcttctggagcaacaagtccgt gcactggagaaggcaagatcaagtgcccaactgcagaccaactacccctcctcagacaac agcctctacaccaacgccaagggcggcaccatctctgccttcgatgggggttcagactcc agctcagagtccgagcctgaggagccccagaacaggaagaaactgcggatggaggccagc taa

DBGET integrated database retrieval system