KEGG   Rattus norvegicus (rat): 63864
Entry
63864             CDS       T01003                                 
Symbol
Hsd17b10
Name
(RefSeq) 3-hydroxyacyl-CoA dehydrogenase type-2
  KO
K08683  3-hydroxyacyl-CoA dehydrogenase / 3-hydroxy-2-methylbutyryl-CoA dehydrogenase [EC:1.1.1.35 1.1.1.178]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00280  Valine, leucine and isoleucine degradation
rno01100  Metabolic pathways
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    63864 (Hsd17b10)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    63864 (Hsd17b10)
   05022 Pathways of neurodegeneration - multiple diseases
    63864 (Hsd17b10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    63864 (Hsd17b10)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    63864 (Hsd17b10)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     63864 (Hsd17b10)
    1.1.1.178  3-hydroxy-2-methylbutyryl-CoA dehydrogenase
     63864 (Hsd17b10)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial ribonuclease P
    63864 (Hsd17b10)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   63864 (Hsd17b10)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase
Other DBs
NCBI-GeneID: 63864
NCBI-ProteinID: NP_113870
RGD: 69231
Ensembl: ENSRNOG00000003049
UniProt: O70351 B0BMW2
Structure
LinkDB
Position
X:21089152..21091597
AA seq 261 aa
MAAACRSVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIF
APANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINV
NLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTL
PIARDLAPIGIRVVTIAPGLFATPLLTTLPDKVRNFLASQVPFPSRLGDPAEYAHLVQMV
IENPFLNGEVIRLDGAIRMQP
NT seq 786 nt   +upstreamnt  +downstreamnt
atggctgcggcgtgtcggagcgtgaagggcctggtggcagtaataaccggaggagcctcg
ggccttggcctgtctacagccaaaagactggtgggacaaggagccacagctgtacttctg
gacgtccctaactcagagggtgagaccgaagccaagaagttaggaggaaactgcatattt
gccccagcaaatgtgacctctgagaaggaggtacaagcagctttgactctagcaaaagaa
aagtttggccgtatagatgtggctgtcaactgtgcaggcattgcagtggccattaagaca
taccacgaaaagaagaaccaggtccacaccttggaggacttccagcgggttatcaatgtg
aatctcataggcactttcaatgtgatccgcctggttgctggtgtgatgggccagaatgaa
ccagaccagggaggtcaacgtggagttatcattaacactgccagtgtggctgcttttgag
ggccaggttggacaagctgcatactctgcatccaaagggggcatagtgggcatgacactg
cccattgctcgagatctggctcctataggcatccgtgtggtaacaattgctccaggtctg
tttgccaccccactgcttaccactctgccagacaaagtgcgcaacttcttggccagccag
gtacccttccccagccgactaggtgaccccgcggaatatgctcatctggtacagatggta
atcgagaacccattcttgaatggagaggtcatccggctggatggggccattcgaatgcag
ccttaa

DBGET integrated database retrieval system