KEGG   Rattus norvegicus (rat): 680127
Entry
680127            CDS       T01003                                 
Symbol
Tirap
Name
(RefSeq) toll/interleukin-1 receptor domain-containing adapter protein
  KO
K05403  toll-interleukin 1 receptor (TIR) domain-containing adaptor protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04620  Toll-like receptor signaling pathway
rno04936  Alcoholic liver disease
rno05132  Salmonella infection
rno05133  Pertussis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    680127 (Tirap)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    680127 (Tirap)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    680127 (Tirap)
  09172 Infectious disease: viral
   05161 Hepatitis B
    680127 (Tirap)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    680127 (Tirap)
   05133 Pertussis
    680127 (Tirap)
   05152 Tuberculosis
    680127 (Tirap)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    680127 (Tirap)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    680127 (Tirap)
SSDB
Motif
Pfam: TIR_2 TIR
Other DBs
NCBI-GeneID: 680127
NCBI-ProteinID: XP_001055833
RGD: 1595496
Ensembl: ENSRNOG00000021420
UniProt: D3ZXA5
LinkDB
Position
8:complement(33531724..33548508)
AA seq 250 aa
MVGLEACAMASSSSVPASSTQSKKPRDKIADWFRQALLKKPKKMPISQESHLSDGSQTAT
QDGLSPSSGSSPRSHSSSQSQSSTPSCSSGMSPTSPPTHVDSSSSSSSGRWSKDYDVCVC
HSEEDLEVAQELVSYLEGSKASLRCFLQFRDAAPGGAIVSELCQALSGSHCRVLLITPGF
LRDPWCKYQMLQALTEAPGSEGCTIPLLSGLTRAAYPPELRFMYYVDGRGQDGGFYQVKE
AVIHYLETLS
NT seq 753 nt   +upstreamnt  +downstreamnt
atggttggtttggaggcctgtgctatggcttcatcctcctccgtcccagcctcctccact
cagtccaagaagcctcgagacaagatagctgactggttcaggcaggctctgttgaagaag
cccaagaagatgccaatctcccaggaaagccacctcagtgatggttcacagacagccaca
caggatggtctctcaccctccagcggcagttcacctcggagtcatagttcatcccagagc
caaagctcaaccccgagctgcagttcaggaatgtctcctacctcaccaccaacacacgtg
gacagcagcagcagcagcagcagtggccgttggagcaaagactatgatgtctgtgtgtgc
cacagtgaggaggatttagaggtggcccaggagcttgtctcctacttggagggtagcaaa
gccagtctacgctgcttcctgcagtttcgggatgcagccccaggtggcgccattgtttct
gagctatgccaggcgctgagtggtagtcactgccgcgtgctgctcatcaccccaggcttc
cttcgggacccctggtgcaagtaccagatgctgcaggccctgacggaagccccagggtcg
gagggatgcactatacccctgctatccggcctgaccagagccgcctatccaccggaactc
cgattcatgtactatgtggatggcagaggccaggatggtggcttttatcaagtcaaggag
gctgttatacactatctggagacactaagttga

DBGET integrated database retrieval system