KEGG   Rattus norvegicus (rat): 83535
Entry
83535             CDS       T01003                                 

Gene name
Kcnj11
Definition
(RefSeq) ATP-sensitive inward rectifier potassium channel 11
  KO
K05004  potassium inwardly-rectifying channel subfamily J member 11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04911  Insulin secretion
rno04929  GnRH secretion
rno04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    83535 (Kcnj11)
   04929 GnRH secretion
    83535 (Kcnj11)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    83535 (Kcnj11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    83535 (Kcnj11)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   83535 (Kcnj11)
SSDB
Motif
Pfam: IRK_C IRK EI24 Ion_trans_2
Other DBs
NCBI-GeneID: 83535
NCBI-ProteinID: NP_112648
RGD: 69247
Ensembl: ENSRNOG00000021128
UniProt: P70673
LinkDB
Structure
PDB: 
6BAA 6PZ9 6PZA 5TWV

Position
1
AA seq 390 aa
MLSRKGIIPEEYVLTRLAEDPTEPRYRTRERRARFVSKKGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPGEGTNVPCVTSIHSFSSA
FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET
LIFSKHAVITLRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDSNSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA
RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDRSLLDALT
LASSRGPLRKRSVAVAKAKPKFSISPDSLS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgctgtcccgaaagggcattatccctgaggaatatgtgctgacccggctggcagaggac
cctacagagcccaggtaccgtactcgggagaggagggcccgcttcgtgtccaagaaaggc
aactgcaacgtcgcccacaagaacatccgagagcagggccgcttcctgcaagatgtgttc
accacgctggtggacctcaagtggccccacacgctgctcattttcaccatgtccttcctg
tgcagctggctgctcttcgccatggtctggtggctcatcgcctttgcccacggtgacttg
gcccccggagagggcaccaatgtgccctgcgtcacaagcatccactccttttcgtctgcc
ttccttttctccatcgaggtccaggtgaccattggtttcggcgggcgcatggtgacagag
gaatgtcccctggccatccttattctgatcgtgcagaatatcgtagggctaatgatcaac
gccatcatgctgggctgcatcttcatgaaaacggcacaggcccatcggcgggcagaaacc
ctcatcttcagcaagcatgccgtgatcaccctgcgacatggccgcctgtgcttcatgctt
cgcgtaggggacctccgaaaaagcatgatcattagcgccaccattcatatgcaggtggtg
cgcaagaccaccagcccggagggcgaggttgtgcctctccaccaggtggacatccccatg
gagaacggtgtgggtggtaacagcatctttctggtggccccactcatcatctaccacgtc
atcgactccaacagcccgctctacgacctggctcctagtgacctgcaccaccaccaggac
ctggagatcattgtcatcttggaaggtgtggtagaaaccacaggcattaccacccaggcc
cgcacctcctatctggctgacgagattctgtgggggcagcgttttgtccccatcgtggcc
gaggaggatggccgctattctgtggactactccaaattcgggaacaccgttaaagtgccc
acaccactctgcacagcccgccagcttgatgaggaccgcagcctgctggatgccctgacc
ctcgcctcgtcgcgagggcccctgcgcaagcgcagtgtggctgtggcaaaggccaagccc
aagtttagcatctctccggattccttgtcctga

DBGET integrated database retrieval system