Rossellomorea sp. y25: V2W31_00480 Help Entry V2W31_00480       CDS       T10157                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ross  Rossellomorea sp. y25 Pathway ross00790   Folate biosynthesis ross01100   Metabolic pathways ross01240   Biosynthesis of cofactors Module ross_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:ross00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     V2W31_00480 (folB) Enzymes [BR:ross01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      V2W31_00480 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      V2W31_00480 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      V2W31_00480 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  WWO81844 LinkDB All DBs Position 95980..96339 Genome browser AA seq 119 aa AA seqDB search MDKILLNEMEFYGYHGVFQEENKLGQRFRVSVELHLDLRKSGQSDQLEDSVNYAEIYSIT KTVVEGEPKNLVEAVAEDISSRILEAFQVVESCKITLIKPDPPIPGHYQSVAVEINRSR NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggataagatcctattgaacgaaatggagttctacggctatcatggtgtgtttcaagaa gagaacaaacttggacaacgttttcgtgttagtgtagagttgcatttagatttaaggaag tccggtcaaagtgatcagcttgaggactccgtaaactatgcggagatctattctatcacg aaaactgtagttgagggagaaccgaagaatttagtggaagcggtcgctgaagacatctct tcccggatcttagaagcattccaagtcgtagagagctgtaaaataacactaatcaagcct gatccacctattcctggacattaccaatcggtggcggtggagattaataggagtcgatag

DBGET integrated database retrieval system