Rouxiella sp. WC2420: AB3G37_21310 Help Entry AB3G37_21310      CDS       T11448                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism rou  Rouxiella sp. WC2420 Pathway rou00670   One carbon pool by folate rou00790   Folate biosynthesis rou01100   Metabolic pathways rou01240   Biosynthesis of cofactors rou04981   Folate transport and metabolism Module rou_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:rou00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     AB3G37_21310 (folA)    00670 One carbon pool by folate     AB3G37_21310 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     AB3G37_21310 (folA) Enzymes [BR:rou01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      AB3G37_21310 (folA) SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 DUF3830 Motif Other DBs NCBI-ProteinID:  XDU72015 LinkDB All DBs Position complement(4619214..4619702) Genome browser AA seq 162 aa AA seqDB search MIISLIAAMAADRVIGMENAMPWHLPGDLAWFKRNTLNKPVIMGRKTFESIGRPLPGRLN IVISSQPGSLDGVTWVSSVDEALSAAGNAEEVMIMGGGKVYTQFLKRANRLYLTHIDAEV EGDTHFPDYEPDEWESVFSEFHDADEANTHGYCFEILDRRGE NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgattatcagcctgatcgctgcaatggcagcggatcgcgttatcggtatggaaaacgct atgccctggcatttaccgggtgacctggcttggttcaagcgtaacacgctgaacaaaccg gttattatggggcgcaagactttcgagtcgattggccgaccattacctggtcgtctaaat atcgttatcagcagccagcctggaagcctggatggcgtaacctgggtaagctctgtcgat gaagctttatctgcagcgggtaatgcagaagaagtgatgattatgggaggggggaaagtc tacacccagttcctcaagcgcgccaaccgcctgtatctgacacacattgatgctgaagtt gaaggggacacgcatttccctgactacgaacctgacgagtgggaaagcgtatttagcgag ttccatgacgcagatgaagcgaacactcacggctattgttttgaaattctggatcgccgc ggcgagtaa

DBGET integrated database retrieval system