KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665456
Entry
104665456         CDS       T03989                                 
Symbol
GNA11
Name
(RefSeq) guanine nucleotide-binding protein subunit alpha-11
  KO
K04635  guanine nucleotide-binding protein subunit alpha-11
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04081  Hormone signaling
rro04082  Neuroactive ligand signaling
rro04270  Vascular smooth muscle contraction
rro04540  Gap junction
rro04725  Cholinergic synapse
rro04730  Long-term depression
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04925  Aldosterone synthesis and secretion
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04929  GnRH secretion
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro05142  Chagas disease
rro05146  Amoebiasis
rro05163  Human cytomegalovirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104665456 (GNA11)
   04022 cGMP-PKG signaling pathway
    104665456 (GNA11)
  09133 Signaling molecules and interaction
   04082 Neuroactive ligand signaling
    104665456 (GNA11)
   04081 Hormone signaling
    104665456 (GNA11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104665456 (GNA11)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104665456 (GNA11)
   04929 GnRH secretion
    104665456 (GNA11)
   04912 GnRH signaling pathway
    104665456 (GNA11)
   04935 Growth hormone synthesis, secretion and action
    104665456 (GNA11)
   04928 Parathyroid hormone synthesis, secretion and action
    104665456 (GNA11)
   04925 Aldosterone synthesis and secretion
    104665456 (GNA11)
   04927 Cortisol synthesis and secretion
    104665456 (GNA11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104665456 (GNA11)
  09156 Nervous system
   04725 Cholinergic synapse
    104665456 (GNA11)
   04730 Long-term depression
    104665456 (GNA11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104665456 (GNA11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104665456 (GNA11)
   05163 Human cytomegalovirus infection
    104665456 (GNA11)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104665456 (GNA11)
   05142 Chagas disease
    104665456 (GNA11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104665456 (GNA11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104665456 (GNA11)
   04031 GTP-binding proteins [BR:rro04031]
    104665456 (GNA11)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104665456 (GNA11)
  Exosomal proteins of melanoma cells
   104665456 (GNA11)
GTP-binding proteins [BR:rro04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    104665456 (GNA11)
SSDB
Motif
Pfam: G-alpha Arf DUF2194 Gtr1_RagA FtsK_SpoIIIE AAA_29
Other DBs
NCBI-GeneID: 104665456
NCBI-ProteinID: XP_010365606
UniProt: A0A2K6PJ32
LinkDB
Position
8:12684832..12714324
AA seq 359 aa
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRSFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEK
VTTFEHQYVSAIKTLWDDPGIQECYDRRREYQLSDSAKYYLTDVDRIATSGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatgatggcgtgttgcctcagcgatgaggtgaaggagtccaagcgg
atcaacgccgagatcgagaagcagctgcggcgggacaagcgcgacgcccggcgcgagctc
aagctgctgctgctcggcacgggcgagagcgggaagagcaccttcatcaagcagatgcgc
atcatccacggcgctggctactcagaggaggacaagcgcagcttcaccaagctcgtctac
cagaacatcttcaccgccatgcaggccatgatccgggccatggagacgctcaagatcctc
tacaagtacgagcagaacaaggccaatgcgctcctgatccgggaggtggacgtggagaag
gtgaccaccttcgagcatcagtacgtaagcgccatcaagaccctgtgggacgaccctggc
atccaggagtgctacgaccgcaggcgcgagtaccagctctccgactctgccaagtactac
ctgaccgatgttgaccgcatcgcaacctcgggctacctgcccacgcagcaggacgtgctg
cgggtccgcgtgcccaccaccggcatcatcgagtaccctttcgacctggagaacatcatc
ttcaggatggtggatgtgggcggccagcggtcggagcggaggaagtggatccactgcttt
gagaacgtgacatccatcatgtttctcgtcgccctcagcgagtacgaccaagtcctggtg
gagtcggacaatgagaaccggatggaggagagcaaagccctgttccggaccatcatcacc
tacccctggttccagaactcctccgtcatcctgttcctcaacaagaaggacctgctggag
gacaagatcctgtactcacacctggtggactacttccccgagttcgacgggccccagcgg
gacgcccaggcggcgcgggagttcatcctgaagatgttcgtggacctgaaccccgacagc
gacaagatcatctactcacacttcacgtgtgccaccgacacagagaacatccgcttcgtg
ttcgcggccgtgaaggacaccatcctgcagctcaacctcaaggaatacaacctggtctga

DBGET integrated database retrieval system