KEGG   Roseiflexus sp. RS-1: RoseRS_1905
Entry
RoseRS_1905       CDS       T00542                                 
Name
(GenBank) Mg-protoporphyrin IX monomethyl ester (oxidative) cyclase
  KO
K04035  magnesium-protoporphyrin IX monomethyl ester (oxidative) cyclase [EC:1.14.13.81]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00860  Porphyrin metabolism
rrs01100  Metabolic pathways
rrs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rrs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    RoseRS_1905
Enzymes [BR:rrs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.81  magnesium-protoporphyrin IX monomethyl ester (oxidative) cyclase
     RoseRS_1905
SSDB
Motif
Pfam: Rubrerythrin E1_4HB DUF2383
Other DBs
NCBI-ProteinID: ABQ90294
LinkDB
Position
complement(2366738..2367853)
AA seq 371 aa
MMNIPGEYTPTTRHALREAILNPRFYTTDFRAIDRLNVAHMRDEFDWIRNEFEVDYNRKH
FVRNDEFLANFDDMPARDLFIEFLERSCTAEFSGCLLYAEMVKHLHDPTLKAIFRCMSRD
EGRHAGFLNKTMADLGVEMNLQVLHTRKKYTYFQPKFIFYSVYLSEKIGYARYITIYRHL
QKYPQGMIHPIFKWFEKWCNDEYRHGEFFSLLMRSQPDLLRGGNLRWIRFFLLAVYATMY
LNDARRAGFYQALGLDWRDYDQRVIRLTNHIATQVFPVTLPVDDPRFFRHLDACVTYDAQ
IRALEGRSDPIATAQRARLGAAIAARLLATYRLPVVPTTDANRWQGLEGFPNYPGPGWKQ
DATLNQRVISA
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgatgaacatacccggcgaatacaccccgacgacgcgccatgcgttgcgtgaggcgatc
ctgaacccgcgtttctacacgaccgacttccgcgcgattgatcggctgaatgttgcgcac
atgcgtgatgagttcgattggatccgcaatgagttcgaggttgattacaaccggaagcat
ttcgtgcgcaacgatgagtttctggcgaatttcgacgatatgccggcgcgcgatctcttc
atcgagttccttgaacgcagttgcacggcggagttcagcggatgtctgctctacgcggaa
atggtcaagcacctgcacgatccaacgctcaaggcaatcttccgctgcatgagccgtgat
gaaggtcgtcatgccggttttctcaataaaaccatggctgatctgggtgtcgagatgaat
ctgcaggtgttgcatacgcgcaagaagtacacctattttcagccaaagtttatcttctac
agtgtctacctgtcggagaagatcggctacgcccgctacatcacgatttatcgtcacttg
cagaaatatccgcagggcatgatccatccgatcttcaaatggttcgagaagtggtgcaac
gacgagtatcgtcacggcgagtttttctcacttttgatgcgcagccagccggatctgcta
cgtggcggcaatctgcgctggatccgcttcttcttgcttgcggtgtacgccacgatgtac
ctgaacgatgcccgtcgcgccggtttctaccaggcgctcggtctcgactggcgcgactat
gatcagcgggtgatccgcctgacgaaccatatcgccacgcaggtgttcccggtgacgctg
ccggtcgatgatccacgcttcttccgtcatctcgacgcatgtgtgacgtatgacgctcag
atacgcgcgctcgaagggcgcagcgatccgattgcaaccgcgcagcgggcgcgattgggc
gctgcgattgcggcgcgtctcctggcgacctaccgcctgccggtcgtgccaaccaccgac
gccaatcgctggcaggggcttgaaggcttcccaaactatcctggaccgggttggaaacag
gatgcaacgctcaatcagcgggtcatatccgcatga

DBGET integrated database retrieval system