Raphanus sativus (radish): 130509350 Help Entry 130509350         CDS       T06014                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism rsz  Raphanus sativus (radish) Pathway rsz03420   Nucleotide excision repair rsz04120   Ubiquitin mediated proteolysis rsz04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:rsz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     130509350    04120 Ubiquitin mediated proteolysis     130509350   09124 Replication and repair    03420 Nucleotide excision repair     130509350  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:rsz04121]     130509350    03400 DNA repair and recombination proteins [BR:rsz03400]     130509350 Enzymes [BR:rsz01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      130509350 Ubiquitin system [BR:rsz04121]  Ubiquitin ligases (E3)   UBL E3 ligases    130509350   Multi subunit type E3    SCF complex     Ring finger protein      130509350    Cul2 complex      130509350    Cul3 complex      130509350    Cul4 complex      130509350    Cul7 complex      130509350    Cul8 complex      130509350    Cul9 complex      130509350 DNA repair and recombination proteins [BR:rsz03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       130509350     TCR (transcription coupled repair) factors      Cul4-CSA complex       130509350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  130509350 NCBI-ProteinID:  XP_056861184 UniProt:  A0A6J0MR11 LinkDB All DBs Position 3:complement(24038952..24040219) Genome browser AA seq 116 aa AA seqDB search MASLDSDVNMIPAGESSNPVVPSSKKAKRFEVKKWSAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcttccctggattccgacgtaaacatgatccctgcaggtgaatcctccaaccccgtc gtcccttcgagcaagaaggcaaagagattcgaagttaagaagtggagcgcggttgctctc tgggcttgggatatagttgttgacaattgcgctatctgcagaaaccacatcatggatctc tgcattgaatgtcaggctaatcaggcaagcgctacgagtgaggaatgcactgttgcttgg ggggtttgcaatcacgccttccacttccactgcatcagcagatggttaaagactcgtcaa gtttgccctttggataacagtgagtgggagttccagaaatatggtcactaa

DBGET integrated database retrieval system