Rana temporaria (common frog): 120924959 Help Entry 120924959         CDS       T07929                                  Name (RefSeq) thymosin beta-11-like   KO K05764   thymosin, beta 4 Organism rtem  Rana temporaria (common frog) Pathway rtem04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:rtem00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     120924959  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:rtem04812]     120924959 Cytoskeleton proteins [BR:rtem04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      120924959 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thymosin Motif Other DBs NCBI-GeneID:  120924959 NCBI-ProteinID:  XP_040191829 LinkDB All DBs Position 1:complement(422420994..422422011) Genome browser AA seq 43 aa AA seqDB search MADKPNLKEIDSFDKSKLKKTETQEKNPLPTKEEIEQEKQGFN NT seq 132 nt NT seq  +upstreamnt  +downstreamnt atggcagacaaaccaaacctgaaagagatcgacagtttcgataagtcaaagctgaagaaa accgagacgcaagagaagaaccccctgcctacgaaagaggaaattgaacaggaaaagcaa ggcttcaattag

DBGET integrated database retrieval system