Rhincodon typus (whale shark): 109925317 Help Entry 109925317         CDS       T06055                                  Symbol il6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism rtp  Rhincodon typus (whale shark) Pathway rtp04060   Cytokine-cytokine receptor interaction rtp04068   FoxO signaling pathway rtp04218   Cellular senescence rtp04620   Toll-like receptor signaling pathway rtp04621   NOD-like receptor signaling pathway rtp04623   Cytosolic DNA-sensing pathway rtp04625   C-type lectin receptor signaling pathway rtp04672   Intestinal immune network for IgA production rtp05132   Salmonella infection rtp05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:rtp00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     109925317 (il6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109925317 (il6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     109925317 (il6)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109925317 (il6)    04621 NOD-like receptor signaling pathway     109925317 (il6)    04623 Cytosolic DNA-sensing pathway     109925317 (il6)    04625 C-type lectin receptor signaling pathway     109925317 (il6)    04672 Intestinal immune network for IgA production     109925317 (il6)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     109925317 (il6)   09171 Infectious disease: bacterial    05132 Salmonella infection     109925317 (il6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:rtp04052]     109925317 (il6) Cytokines and neuropeptides [BR:rtp04052]  Cytokines   Interleukins    109925317 (il6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL6 IL11 Motif Other DBs NCBI-GeneID:  109925317 NCBI-ProteinID:  XP_020380863 LinkDB All DBs Position 2:complement(79629144..79632862) Genome browser AA seq 209 aa AA seqDB search MGVTAAWMSPVAVTSLPESSGDFADVYTTGTPPSAGNMNLEPLALFIQNIATELRKRQLC DYFSMCDGTSNSLNMYNRELPQIRKKDKCFESSFQKKKCLTKIVKGFQGYKKYLQFVSQW IEVDNLQVNAMLSSAKILVDLLPLESKIRERIAQQDKGNEEAFNLEESSKTDWNKQVTVH VILRNFALFMESTIRAIRFMQSAPATASL NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atgggggtaacagccgcctggatgtctccagttgctgtcacctcgctccccgaatcttcc ggagactttgcagacgtttatacaactggaactccccccagtgctggaaatatgaatctt gaacctttggctcttttcatccagaatattgccaccgaactgcgcaaacgacagctgtgc gattatttttccatgtgcgatggcacgtcaaattcactgaatatgtacaacagggaactg ccacagattcgaaagaaagataaatgttttgagagcagtttccagaagaaaaagtgtttg accaagattgtcaagggatttcagggctataagaagtacctgcagtttgtgagtcaatgg attgaagttgataatttgcaagtgaatgcaatgctgagcagcgcaaagattttggttgac ctgctcccattggagagcaaaattcgtgaacgtattgctcaacaagataaaggtaacgaa gaggctttcaatctggaagagtcttctaaaacagactggaataagcaagtgactgttcat gtgattcttagaaattttgctctctttatggagagtactattcgagccattcgattcatg caatcagcacctgcaacagcttcattatga

DBGET integrated database retrieval system