KEGG   Streptomyces albireticuli: SMD11_0076
Entry
SMD11_0076        CDS       T05230                                 
Symbol
ptlI
Name
(GenBank) cytochrome P450
  KO
K15907  pentalenene oxygenase [EC:1.14.15.32]
Organism
salj  Streptomyces albireticuli
Pathway
salj00909  Sesquiterpenoid and triterpenoid biosynthesis
salj00998  Biosynthesis of various antibiotics
salj01100  Metabolic pathways
salj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:salj00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    SMD11_0076 (ptlI)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    SMD11_0076 (ptlI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:salj00199]
    SMD11_0076 (ptlI)
Enzymes [BR:salj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.32  pentalenene oxygenase
     SMD11_0076 (ptlI)
Cytochrome P450 [BR:salj00199]
 Cytochrome P450, bacteria type
  CYP183 family
   SMD11_0076 (ptlI)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: ARZ65743
UniProt: A0A1Z2KUL3
LinkDB
Position
complement(73371..74756)
AA seq 461 aa
MPETYAAANAPGALPLVGHAWPLLHRPIPFLSSLPQYGDLVEIRLGRVRAHVPCHPQLLR
RVLSDDRTYDKGGPLFTRLRDLVGNGLGSCPHRDHRRQRRLLQPAFHRTRIETYAHVMTD
EALRLSATWQPGQTVDAFPAMFELALRTVTRTLFSSRVGDDDVARLQHSFETALAGLFRR
IFVPAPLQHLPLPANRRYARALADLHGSVDHLIAGYLSTDENTGADTSPDTHHAQDREDL
LSTLIAARDDDTALSDGELHDQVITMLLGGAETVAAALTWALYALTRNPRVAHDLHDEVD
TVLAGRPPAHRDLPHLPRTGHMISETLRLYPPAWLFTRITTRPLNLAGRYLPSGTTLVIS
PPALHHNPALYPRAADFCPDRWSEERPGLPPRGEFTGFGAGARRCLGDTYAVAEATLTLA
TLAQRWRMECAPGTDIRPAPLSAVHRPRRLLLHLTPRTRVG
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgcccgaaacgtacgccgccgcaaacgcccccggagccctccccctcgtcggccacgcc
tggcccctgctccaccgccccatccccttcctcagctccctcccgcaatacggcgacctc
gtcgagatccgcctcggacgcgtccgggcccacgtcccctgccacccccagctcctgcgc
cgcgtcctgtccgacgaccgcacctacgacaaaggcggccccctcttcacccgcctgcgc
gacctcgtcggcaacggcctgggcagctgcccccaccgcgaccaccgccgccagcgccgc
ctcctccagcccgccttccaccgcacccgcatcgagacctacgcccacgtcatgaccgac
gaggccctgcgcctgagcgccacctggcagcccggccagaccgtcgacgccttccccgcc
atgttcgaactcgccctgcgcaccgtcacccgcaccctcttctcctcccgcgtcggcgac
gacgacgtggcccgcctccagcactccttcgaaaccgcactcgccggcctcttccgccgc
atcttcgtccccgcccccctccagcacctccccctccccgccaaccgccgctacgcccgc
gccctggccgacctccacggctccgtcgaccacctcatcgccggctacctcagcaccgac
gagaacaccggcgccgacaccagccccgacacccaccacgcccaggaccgggaagacctc
ctgtccaccctcatcgccgcccgcgacgacgacaccgccctcagcgacggcgaactccac
gaccaggtcatcaccatgctcctgggcggcgccgaaaccgtcgccgccgccctgacctgg
gccctgtacgccctgacccgcaacccccgcgtcgcccacgacctccacgacgaggtcgac
accgtcctggccggccgcccacccgcccaccgcgacctgccccacctgccccgcaccggc
cacatgatcagcgaaaccctgcgcctgtacccgcccgcatggctgttcacccgcatcacc
acccgccccctcaacctcgccggccgctacctgccctccggcaccaccctcgtcatcagc
ccgcccgccctccaccacaaccccgccctctacccccgcgccgccgacttctgccccgac
cgctggagcgaggaacgcccgggcctgccgcccagaggcgagttcaccggcttcggcgcc
ggcgcccgccgctgcctgggcgacacctacgccgtcgccgaggccaccttgaccctcgcc
accctcgcccagcgatggcggatggaatgcgccccgggcaccgacatccgccccgccccc
ctctccgccgtccaccgcccccgccgcctcctgctgcacctcaccccccgcacccgggtg
ggctga

DBGET integrated database retrieval system