Salvelinus sp. IW2-2015 (Arctic char): 111965561 Help Entry 111965561         CDS       T05762                                  Name (RefSeq) RING-box protein 1-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism salp  Salvelinus sp. IW2-2015 (Arctic char) Pathway salp03420   Nucleotide excision repair salp04110   Cell cycle salp04114   Oocyte meiosis salp04120   Ubiquitin mediated proteolysis salp04141   Protein processing in endoplasmic reticulum salp04310   Wnt signaling pathway salp04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:salp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111965561    04120 Ubiquitin mediated proteolysis     111965561   09124 Replication and repair    03420 Nucleotide excision repair     111965561  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     111965561    04350 TGF-beta signaling pathway     111965561  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     111965561    04114 Oocyte meiosis     111965561  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:salp04121]     111965561    03400 DNA repair and recombination proteins [BR:salp03400]     111965561 Enzymes [BR:salp01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      111965561 Ubiquitin system [BR:salp04121]  Ubiquitin ligases (E3)   UBL E3 ligases    111965561   Multi subunit type E3    SCF complex     Ring finger protein      111965561    Cul2 complex      111965561    Cul3 complex      111965561    Cul4 complex      111965561    Cul7 complex      111965561    Cul8 complex      111965561    Cul9 complex      111965561 DNA repair and recombination proteins [BR:salp03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       111965561     TCR (transcription coupled repair) factors      Cul4-CSA complex       111965561 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-RING_11 SCIFF PHD_NSD Motif Other DBs NCBI-GeneID:  111965561 NCBI-ProteinID:  XP_023845487 LinkDB All DBs Position LG6.2:12351644..12352069 Genome browser AA seq 94 aa AA seqDB search MDRMAAVMDVDTPSAMNSGASNKRFEVKKWNEVVLWAWDIVVDNCAICSNHMRDLCIECQ ANQASATSEECTVAWGVCNHAFHFHCISRWLKTR NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggatagaatggcggcagtaatggatgttgataccccaagcgccatgaatagtggagca agcaacaaacgttttgaagtgaagaagtggaatgaagtggtactttgggcctgggacatt gtggtggacaactgtgccatctgtagcaatcacatgagggatctctgcatagagtgccag gctaaccaggcctctgccacgtcagaggagtgcaccgtagcctggggagtctgcaatcat gcattccatttccactgtatctcccgttggttgaagaccaggtag

DBGET integrated database retrieval system