Salvelinus sp. IW2-2015 (Arctic char): 111981970 Help Entry 111981970         CDS       T05762                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism salp  Salvelinus sp. IW2-2015 (Arctic char) Pathway salp03420   Nucleotide excision repair salp04110   Cell cycle salp04114   Oocyte meiosis salp04120   Ubiquitin mediated proteolysis salp04141   Protein processing in endoplasmic reticulum salp04310   Wnt signaling pathway salp04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:salp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111981970    04120 Ubiquitin mediated proteolysis     111981970   09124 Replication and repair    03420 Nucleotide excision repair     111981970  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     111981970    04350 TGF-beta signaling pathway     111981970  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     111981970    04114 Oocyte meiosis     111981970  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:salp04121]     111981970    03400 DNA repair and recombination proteins [BR:salp03400]     111981970 Enzymes [BR:salp01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      111981970 Ubiquitin system [BR:salp04121]  Ubiquitin ligases (E3)   UBL E3 ligases    111981970   Multi subunit type E3    SCF complex     Ring finger protein      111981970    Cul2 complex      111981970    Cul3 complex      111981970    Cul4 complex      111981970    Cul7 complex      111981970    Cul8 complex      111981970    Cul9 complex      111981970 DNA repair and recombination proteins [BR:salp03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       111981970     TCR (transcription coupled repair) factors      Cul4-CSA complex       111981970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Arif-1 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  111981970 NCBI-ProteinID:  XP_023869242 LinkDB All DBs Position LG20:complement(2522611..2525779) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSATNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcagcgatggatgttgataccccaagcgccacaaatagtggagcaagcaagaaa cgttttgaagtgaagaagtggaatgcagtggcactttgggcctgggacattgtggtggac aactgtgccatctgtaggaatcacattatggatctctgcatagagtgccaggctaaccag gcctctgccacatcagaggagtgcaccgtagcttggggagtctgcaatcatgcattccat ttccactgtatctcccgttggttgaagaccaggcaggtgtgccccctagacaacagggag tgggagtttcagaaatatggacactag

DBGET integrated database retrieval system