Salvelinus sp. IW2-2015 (Arctic char): 112072990 Help Entry 112072990         CDS       T05762                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism salp  Salvelinus sp. IW2-2015 (Arctic char) Pathway salp03420   Nucleotide excision repair salp04110   Cell cycle salp04114   Oocyte meiosis salp04120   Ubiquitin mediated proteolysis salp04141   Protein processing in endoplasmic reticulum salp04310   Wnt signaling pathway salp04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:salp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     112072990    04120 Ubiquitin mediated proteolysis     112072990   09124 Replication and repair    03420 Nucleotide excision repair     112072990  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     112072990    04350 TGF-beta signaling pathway     112072990  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     112072990    04114 Oocyte meiosis     112072990  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:salp04121]     112072990    03400 DNA repair and recombination proteins [BR:salp03400]     112072990 Enzymes [BR:salp01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      112072990 Ubiquitin system [BR:salp04121]  Ubiquitin ligases (E3)   UBL E3 ligases    112072990   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      112072990    Cul2 complex      112072990    Cul3 complex      112072990    Cul4 complex      112072990    Cul7 complex      112072990    Cul8 complex      112072990    Cul9 complex      112072990 DNA repair and recombination proteins [BR:salp03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       112072990     TCR (transcription coupled repair) factors      Cul4-CSA complex       112072990 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  112072990 NCBI-ProteinID:  XP_023996130 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPSATNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcagcgatggatgttgataccccaagcgccacgaatagtggagcaagcaagaaa cgttttgaagtgaagaagtggaatgcagtggcactttgggcctgggacattgtggtggac aactgtgccatctgtaggaatcacattatggatctctgcatagagtgccaggctaaccag gcctctgccacatcagaggagtgcaccgtagcctggggagtctgcaatcatgcattccat ttccactgtatctcccgttggttgaagaccaggcaggtgtgtcccctagacaacagggag tgggagtttcagaaatatggacactag

DBGET integrated database retrieval system