Sinocyclocheilus anshuiensis: 107669591 Help Entry 107669591         CDS       T04917                                  Name (RefSeq) ras-related protein Rap-1A-like   KO K04353   Ras-related protein Rap-1A Organism sanh  Sinocyclocheilus anshuiensis Pathway sanh04010   MAPK signaling pathway sanh04510   Focal adhesion sanh04517   IgSF CAM signaling sanh04520   Adherens junction sanh04530   Tight junction Brite KEGG Orthology (KO) [BR:sanh00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     107669591   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     107669591  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     107669591    04520 Adherens junction     107669591    04530 Tight junction     107669591  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:sanh04031]     107669591 GTP-binding proteins [BR:sanh04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     107669591 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  107669591 NCBI-ProteinID:  XP_016317381 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search ITAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGN KCDLEDERVVGKEQGQNFARQWSNCAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKRA KKKSNCILL NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atcactgcaggcacagagcagttcacagcgatgcgggacctgtacatgaagaacgggcag ggtttcgctctggtttactccatcacagcacagtccacctttaatgacctgcaggaccta cgggagcagattctgagagtgaaggacacagaggatgtgccaatgatcttggttgggaat aagtgtgatttagaggatgagagggtggttgggaaggagcagggtcagaattttgctcgt cagtggagtaattgtgcctttctagaatcttctgccaaatcaaagatcaacgtcaatgag atcttttatgacctggtaagacagataaacagaaagacgccggtggagaagaagagagcg aaaaagaagtcaaactgcatcctgctgtaa

DBGET integrated database retrieval system