Sinocyclocheilus anshuiensis: 107672143 Help Entry 107672143         CDS       T04917                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sanh  Sinocyclocheilus anshuiensis Pathway sanh03420   Nucleotide excision repair sanh04110   Cell cycle sanh04114   Oocyte meiosis sanh04120   Ubiquitin mediated proteolysis sanh04141   Protein processing in endoplasmic reticulum sanh04310   Wnt signaling pathway sanh04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:sanh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107672143 (rbx1)    04120 Ubiquitin mediated proteolysis     107672143 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     107672143 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     107672143 (rbx1)    04350 TGF-beta signaling pathway     107672143 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     107672143 (rbx1)    04114 Oocyte meiosis     107672143 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sanh04121]     107672143 (rbx1)    03400 DNA repair and recombination proteins [BR:sanh03400]     107672143 (rbx1) Enzymes [BR:sanh01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      107672143 (rbx1) Ubiquitin system [BR:sanh04121]  Ubiquitin ligases (E3)   UBL E3 ligases    107672143 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      107672143 (rbx1)    Cul2 complex      107672143 (rbx1)    Cul3 complex      107672143 (rbx1)    Cul4 complex      107672143 (rbx1)    Cul7 complex      107672143 (rbx1)    Cul8 complex      107672143 (rbx1)    Cul9 complex      107672143 (rbx1) DNA repair and recombination proteins [BR:sanh03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       107672143 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       107672143 (rbx1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  107672143 NCBI-ProteinID:  XP_016320729 UniProt:  A0A671K6Q5 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPGGTNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggccgcgatggatgtagacactccgggtggaactaacagtggagccagtaaaaag cgttttgaagtgaaaaagtggaatgctgtggctctgtgggcttgggacattgtggtggac aactgtgccatttgcagaaatcacattatggacctctgtatagagtgtcaggccaatcag gcgtcagctacatcagaggagtgtacagtggcctggggagtctgtaatcatgcgtttcat ttccactgcatctctcgctggctgaagaccagacaggtgtgtcctctggacaacagagag tgggagttccagaagtacggccattag

DBGET integrated database retrieval system