Sinocyclocheilus anshuiensis: 107695112 Help Entry 107695112         CDS       T04917                                  Name (RefSeq) RING-box protein 1-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sanh  Sinocyclocheilus anshuiensis Pathway sanh03420   Nucleotide excision repair sanh04110   Cell cycle sanh04114   Oocyte meiosis sanh04120   Ubiquitin mediated proteolysis sanh04141   Protein processing in endoplasmic reticulum sanh04310   Wnt signaling pathway sanh04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:sanh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107695112    04120 Ubiquitin mediated proteolysis     107695112   09124 Replication and repair    03420 Nucleotide excision repair     107695112  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     107695112    04350 TGF-beta signaling pathway     107695112  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     107695112    04114 Oocyte meiosis     107695112  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sanh04121]     107695112    03400 DNA repair and recombination proteins [BR:sanh03400]     107695112 Enzymes [BR:sanh01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      107695112 Ubiquitin system [BR:sanh04121]  Ubiquitin ligases (E3)   UBL E3 ligases    107695112   Multi subunit type E3    SCF complex     Ring finger protein      107695112    Cul2 complex      107695112    Cul3 complex      107695112    Cul4 complex      107695112    Cul7 complex      107695112    Cul8 complex      107695112    Cul9 complex      107695112 DNA repair and recombination proteins [BR:sanh03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       107695112     TCR (transcription coupled repair) factors      Cul4-CSA complex       107695112 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  107695112 NCBI-ProteinID:  XP_016350405 LinkDB All DBs Position Unknown AA seq 88 aa AA seqDB search MAAAMDWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFH FHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggcggctgcgatggattggaatgctgtggctctgtgggcttgggacattgtggtggac aactgtgccatctgcagaaatcacattatggacctctgtatagagtgtcaggccaatcag gcgtcggctacatcagaggagtgtacagtggcctggggagtctgtaatcatgcgtttcat ttccactgcatctctcgctggctgaagaccagacaggtgtgtcctctggacaatagagag tgggagttccagaagtacggccattag

DBGET integrated database retrieval system