Sorex araneus (European shrew): 101539338 Help Entry 101539338         CDS       T07854                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism sara  Sorex araneus (European shrew) Pathway sara04060   Cytokine-cytokine receptor interaction sara04151   PI3K-Akt signaling pathway sara04630   JAK-STAT signaling pathway sara04640   Hematopoietic cell lineage sara04657   IL-17 signaling pathway sara04658   Th1 and Th2 cell differentiation sara04659   Th17 cell differentiation sara04660   T cell receptor signaling pathway sara04664   Fc epsilon RI signaling pathway sara04672   Intestinal immune network for IgA production sara05140   Leishmaniasis sara05200   Pathways in cancer sara05310   Asthma sara05320   Autoimmune thyroid disease sara05321   Inflammatory bowel disease sara05330   Allograft rejection Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101539338 (IL4)    04151 PI3K-Akt signaling pathway     101539338 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101539338 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     101539338 (IL4)    04660 T cell receptor signaling pathway     101539338 (IL4)    04658 Th1 and Th2 cell differentiation     101539338 (IL4)    04659 Th17 cell differentiation     101539338 (IL4)    04657 IL-17 signaling pathway     101539338 (IL4)    04664 Fc epsilon RI signaling pathway     101539338 (IL4)    04672 Intestinal immune network for IgA production     101539338 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101539338 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     101539338 (IL4)   09163 Immune disease    05310 Asthma     101539338 (IL4)    05320 Autoimmune thyroid disease     101539338 (IL4)    05321 Inflammatory bowel disease     101539338 (IL4)    05330 Allograft rejection     101539338 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sara04052]     101539338 (IL4)    00536 Glycosaminoglycan binding proteins [BR:sara00536]     101539338 (IL4) Cytokines and neuropeptides [BR:sara04052]  Cytokines   Interleukins    101539338 (IL4) Glycosaminoglycan binding proteins [BR:sara00536]  Heparan sulfate / Heparin   Cytokines    101539338 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 Motif Other DBs NCBI-GeneID:  101539338 NCBI-ProteinID:  XP_004610022 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MGLASQLMATLLCLLACTSNMAHVHRKTIVLREVIRTLNTLTERKDACLELTVADVFAAP KNTTRTELFCRAATVLRQFYKDHKCLYRFLRGLDKNLSSLANMTHCPVTEDRKSTLKSLL ERLNTITKEKYFHSSS NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgggtctcgcctcccaactgatggccactctgctctgcttactagcatgtaccagcaac atggcccatgtacacagaaagactattgtcctgcgagaggtcatcagaacgctgaacact ctcacagaaagaaaggatgcctgtctggagctgaccgtagcagatgtcttcgctgcccca aagaatacaaccaggacggaactcttctgcagggccgctacggtgctccggcagttctat aaggatcacaaatgtctatatcgcttcctgagggggctcgacaagaacctcagcagcctg gccaacatgacccattgtccagtgacagaagacaggaagagtacactcaaaagcctcttg gaaaggctgaataccatcacgaaagagaaatacttccattcttcaagttga

DBGET integrated database retrieval system