Sorex araneus (European shrew): 101540825 Help Entry 101540825         CDS       T07854                                  Name (RefSeq) phospholipase A2-like   KO K01047   secretory phospholipase A2 [EC:3.1.1.4] Organism sara  Sorex araneus (European shrew) Pathway sara00564   Glycerophospholipid metabolism sara00565   Ether lipid metabolism sara00590   Arachidonic acid metabolism sara00591   Linoleic acid metabolism sara00592   alpha-Linolenic acid metabolism sara01100   Metabolic pathways sara04014   Ras signaling pathway sara04270   Vascular smooth muscle contraction sara04972   Pancreatic secretion sara04975   Fat digestion and absorption Brite KEGG Orthology (KO) [BR:sara00001]  09100 Metabolism   09103 Lipid metabolism    00564 Glycerophospholipid metabolism     101540825    00565 Ether lipid metabolism     101540825    00590 Arachidonic acid metabolism     101540825    00591 Linoleic acid metabolism     101540825    00592 alpha-Linolenic acid metabolism     101540825  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101540825  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     101540825   09154 Digestive system    04972 Pancreatic secretion     101540825    04975 Fat digestion and absorption     101540825  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sara03036]     101540825 Enzymes [BR:sara01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.1  Carboxylic-ester hydrolases     3.1.1.4  phospholipase A2      101540825 Chromosome and associated proteins [BR:sara03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     101540825 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Phospholip_A2_1 Phospholip_A2_4 Motif Other DBs NCBI-GeneID:  101540825 NCBI-ProteinID:  XP_004611278 LinkDB All DBs Position Unknown AA seq 150 aa AA seqDB search MKLLVLAAWLSVATTVDGLSTLNAQSIPQFGKMISCLIPSMSPLKFNKYGCYCGIGGYGT PVDELDRCCLTHDNCYGQAVKLGHCSSLLDHPYFKWYSYSCTKSKVVCSSKNNPCEDFLC HCDLAAAICFSKVPYNEEYKNLDRNKYCKP NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgaagctgctcgtgctggctgcctggctctcagtggccactacagtggacggtctcagc actctcaacgcgcaaagtattccacagttcggaaaaatgatctcgtgcctgatccctagc atgagtcctttgaaatttaacaagtacggctgctactgtggcataggtggatacggcacc cccgtggatgaactggacagatgctgcctgacacacgacaactgctatggccaagccgta aagttgggacactgcagctctctcctggaccacccctactttaagtggtactcctactcc tgcaccaagtccaaggtcgtctgcagtagcaagaacaacccttgcgaggatttcctctgc cattgtgaccttgctgccgccatctgcttttccaaggtcccgtacaacgaggagtacaag aacctggacagaaataagtactgtaagccatga

DBGET integrated database retrieval system