Sorex araneus (European shrew): 101543163 Help Entry 101543163         CDS       T07854                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism sara  Sorex araneus (European shrew) Pathway sara01523   Antifolate resistance sara04010   MAPK signaling pathway sara04014   Ras signaling pathway sara04024   cAMP signaling pathway sara04062   Chemokine signaling pathway sara04064   NF-kappa B signaling pathway sara04066   HIF-1 signaling pathway sara04071   Sphingolipid signaling pathway sara04137   Mitophagy - animal sara04151   PI3K-Akt signaling pathway sara04210   Apoptosis sara04211   Longevity regulating pathway sara04218   Cellular senescence sara04380   Osteoclast differentiation sara04613   Neutrophil extracellular trap formation sara04620   Toll-like receptor signaling pathway sara04621   NOD-like receptor signaling pathway sara04622   RIG-I-like receptor signaling pathway sara04623   Cytosolic DNA-sensing pathway sara04625   C-type lectin receptor signaling pathway sara04657   IL-17 signaling pathway sara04658   Th1 and Th2 cell differentiation sara04659   Th17 cell differentiation sara04660   T cell receptor signaling pathway sara04662   B cell receptor signaling pathway sara04668   TNF signaling pathway sara04722   Neurotrophin signaling pathway sara04917   Prolactin signaling pathway sara04920   Adipocytokine signaling pathway sara04926   Relaxin signaling pathway sara04931   Insulin resistance sara04932   Non-alcoholic fatty liver disease sara04933   AGE-RAGE signaling pathway in diabetic complications sara04936   Alcoholic liver disease sara05010   Alzheimer disease sara05022   Pathways of neurodegeneration - multiple diseases sara05030   Cocaine addiction sara05132   Salmonella infection sara05133   Pertussis sara05134   Legionellosis sara05135   Yersinia infection sara05140   Leishmaniasis sara05142   Chagas disease sara05145   Toxoplasmosis sara05146   Amoebiasis sara05152   Tuberculosis sara05160   Hepatitis C sara05161   Hepatitis B sara05162   Measles sara05163   Human cytomegalovirus infection sara05164   Influenza A sara05165   Human papillomavirus infection sara05166   Human T-cell leukemia virus 1 infection sara05167   Kaposi sarcoma-associated herpesvirus infection sara05168   Herpes simplex virus 1 infection sara05169   Epstein-Barr virus infection sara05170   Human immunodeficiency virus 1 infection sara05171   Coronavirus disease - COVID-19 sara05200   Pathways in cancer sara05202   Transcriptional misregulation in cancer sara05203   Viral carcinogenesis sara05207   Chemical carcinogenesis - receptor activation sara05208   Chemical carcinogenesis - reactive oxygen species sara05212   Pancreatic cancer sara05215   Prostate cancer sara05220   Chronic myeloid leukemia sara05221   Acute myeloid leukemia sara05222   Small cell lung cancer sara05235   PD-L1 expression and PD-1 checkpoint pathway in cancer sara05321   Inflammatory bowel disease sara05415   Diabetic cardiomyopathy sara05417   Lipid and atherosclerosis sara05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101543163 (RELA)    04014 Ras signaling pathway     101543163 (RELA)    04064 NF-kappa B signaling pathway     101543163 (RELA)    04668 TNF signaling pathway     101543163 (RELA)    04066 HIF-1 signaling pathway     101543163 (RELA)    04071 Sphingolipid signaling pathway     101543163 (RELA)    04024 cAMP signaling pathway     101543163 (RELA)    04151 PI3K-Akt signaling pathway     101543163 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     101543163 (RELA)   09143 Cell growth and death    04210 Apoptosis     101543163 (RELA)    04218 Cellular senescence     101543163 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101543163 (RELA)    04620 Toll-like receptor signaling pathway     101543163 (RELA)    04621 NOD-like receptor signaling pathway     101543163 (RELA)    04622 RIG-I-like receptor signaling pathway     101543163 (RELA)    04623 Cytosolic DNA-sensing pathway     101543163 (RELA)    04625 C-type lectin receptor signaling pathway     101543163 (RELA)    04660 T cell receptor signaling pathway     101543163 (RELA)    04658 Th1 and Th2 cell differentiation     101543163 (RELA)    04659 Th17 cell differentiation     101543163 (RELA)    04657 IL-17 signaling pathway     101543163 (RELA)    04662 B cell receptor signaling pathway     101543163 (RELA)    04062 Chemokine signaling pathway     101543163 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     101543163 (RELA)    04917 Prolactin signaling pathway     101543163 (RELA)    04926 Relaxin signaling pathway     101543163 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     101543163 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     101543163 (RELA)   09149 Aging    04211 Longevity regulating pathway     101543163 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101543163 (RELA)    05202 Transcriptional misregulation in cancer     101543163 (RELA)    05207 Chemical carcinogenesis - receptor activation     101543163 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     101543163 (RELA)    05203 Viral carcinogenesis     101543163 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101543163 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     101543163 (RELA)    05221 Acute myeloid leukemia     101543163 (RELA)    05220 Chronic myeloid leukemia     101543163 (RELA)    05215 Prostate cancer     101543163 (RELA)    05222 Small cell lung cancer     101543163 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101543163 (RELA)    05170 Human immunodeficiency virus 1 infection     101543163 (RELA)    05161 Hepatitis B     101543163 (RELA)    05160 Hepatitis C     101543163 (RELA)    05171 Coronavirus disease - COVID-19     101543163 (RELA)    05164 Influenza A     101543163 (RELA)    05162 Measles     101543163 (RELA)    05168 Herpes simplex virus 1 infection     101543163 (RELA)    05163 Human cytomegalovirus infection     101543163 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     101543163 (RELA)    05169 Epstein-Barr virus infection     101543163 (RELA)    05165 Human papillomavirus infection     101543163 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     101543163 (RELA)    05135 Yersinia infection     101543163 (RELA)    05133 Pertussis     101543163 (RELA)    05134 Legionellosis     101543163 (RELA)    05152 Tuberculosis     101543163 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     101543163 (RELA)    05145 Toxoplasmosis     101543163 (RELA)    05140 Leishmaniasis     101543163 (RELA)    05142 Chagas disease     101543163 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     101543163 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     101543163 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     101543163 (RELA)   09165 Substance dependence    05030 Cocaine addiction     101543163 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101543163 (RELA)    05418 Fluid shear stress and atherosclerosis     101543163 (RELA)    05415 Diabetic cardiomyopathy     101543163 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101543163 (RELA)    04932 Non-alcoholic fatty liver disease     101543163 (RELA)    04931 Insulin resistance     101543163 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     101543163 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     101543163 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:sara03000]     101543163 (RELA) Transcription factors [BR:sara03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     101543163 (RELA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  101543163 NCBI-ProteinID:  XP_012790426 LinkDB All DBs Position Unknown AA seq 521 aa AA seqDB search MRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRAHPHELV GKDCRDGYYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIRTDNNPFHVPIEEQRGD YDLNAVRLCFQVTVRDITGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDE IFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPGLQAPVRVSMQ LRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTDPRPSPRRI AVPTRSTAAVSKPAPQSYPFTPSLSTIKFEELPPMVYPPGQMPSQTSALAPATAPVLAQA PAPAPAMAPVLAQGPPTATPLLAPGLPLATAPPAPRPATAGDGALSEALLQLQFDTDEDL AALLGASTDPAVFTDLASVDNSDFQQLLSQGVSAPPAAAEPMLMEYPESITRLVTGSQRP PDPAPAPLGAPGLSNGLLPGDEDFSSIADMDFSALLSQISS NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt atgcgtttccgctacaagtgcgagggccgctctgcgggcagcatccccggggagcggagc acggacaccaccaagacgcaccccaccatcaagatcaatggctacacaggcccagggaca gttcgcatctccctggtcaccaaggacccccctcaccgggctcacccccacgagctggtg gggaaggactgtcgcgatggctactacgaggctgagctctgcccggaccgctgcatccac agtttccagaacctggggatccagtgtgtgaagaagcgggacctggagcaggccatcagc cagcgcatccggaccgacaacaaccccttccacgttcccatcgaggagcagcgcggggac tatgacctgaacgccgtgcggctctgcttccaggtcaccgtgcgcgacatcaccggcagg ccgctccgcctgccccccgtcctgtctcatcccatctttgacaaccgtgcccccaatact gccgagctcaagatttgccgagtgaaccggaactcggggagctgcctcgggggtgacgag atcttcctgctgtgtgacaaagtgcaaaaagaggacattgaggtgtacttcacgggaccg ggctgggaggcccgaggctccttctcccaagccgatgtccaccggcaagtggccatcgtg ttccggaccccgccctacgcagaccccggcctgcaggcccccgtccgcgtctccatgcag ctgcggcggccctcggaccgggagctgagcgagcccatggaattccagtacctgccagac acagatgaccgtcaccggattgaggagaaacgcaagaggacatatgaaacctttaagagc atcatgaagaagagtcctttcaatgggcccacggacccccggccttcgcccaggcgcatt gctgtgcccacccggagcacagctgctgtctccaagccagctccccagtcctatcccttc acgccatccctcagcaccatcaagtttgaggagttaccccccatggtctatcctcccggg cagatgccaagccagacctcggccttggcaccggccactgccccagtcctggcccaggcc cctgcccctgcccccgccatggccccagtgttggcgcagggcccccctaccgccaccccg cttctcgcgcctggcctgcccctggccacagcccctcctgcgcccaggcccgccacagcc ggggacggtgccctgtccgaggctctgctgcagctgcagtttgacaccgatgaggacctg gcggccctgctcggcgccagcacggaccctgccgtgttcaccgacctggcgtcagtcgat aactccgacttccagcagctgctcagccagggagtctctgcgccccccgccgcagctgag cccatgctaatggagtaccccgaatctatcacccgcctggtaacagggtcccagaggccc cctgacccagctcctgcccctctgggggctcctgggctgtccaatgggcttctgccaggg gacgaagatttctcctccatcgcggacatggacttctcagcccttctgagtcagatcagc tcctaa

DBGET integrated database retrieval system