Sorex araneus (European shrew): 101545059 Help Entry 101545059         CDS       T07854                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos isoform X1   KO K04379   proto-oncogene protein c-fos Organism sara  Sorex araneus (European shrew) Pathway sara01522   Endocrine resistance sara04010   MAPK signaling pathway sara04024   cAMP signaling pathway sara04210   Apoptosis sara04380   Osteoclast differentiation sara04620   Toll-like receptor signaling pathway sara04657   IL-17 signaling pathway sara04658   Th1 and Th2 cell differentiation sara04659   Th17 cell differentiation sara04660   T cell receptor signaling pathway sara04662   B cell receptor signaling pathway sara04668   TNF signaling pathway sara04713   Circadian entrainment sara04725   Cholinergic synapse sara04728   Dopaminergic synapse sara04915   Estrogen signaling pathway sara04917   Prolactin signaling pathway sara04921   Oxytocin signaling pathway sara04926   Relaxin signaling pathway sara04928   Parathyroid hormone synthesis, secretion and action sara04932   Non-alcoholic fatty liver disease sara04935   Growth hormone synthesis, secretion and action sara05031   Amphetamine addiction sara05132   Salmonella infection sara05133   Pertussis sara05135   Yersinia infection sara05140   Leishmaniasis sara05142   Chagas disease sara05161   Hepatitis B sara05162   Measles sara05166   Human T-cell leukemia virus 1 infection sara05167   Kaposi sarcoma-associated herpesvirus infection sara05170   Human immunodeficiency virus 1 infection sara05171   Coronavirus disease - COVID-19 sara05200   Pathways in cancer sara05207   Chemical carcinogenesis - receptor activation sara05208   Chemical carcinogenesis - reactive oxygen species sara05210   Colorectal cancer sara05224   Breast cancer sara05231   Choline metabolism in cancer sara05235   PD-L1 expression and PD-1 checkpoint pathway in cancer sara05323   Rheumatoid arthritis sara05417   Lipid and atherosclerosis sara05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101545059 (FOS)    04668 TNF signaling pathway     101545059 (FOS)    04024 cAMP signaling pathway     101545059 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     101545059 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101545059 (FOS)    04660 T cell receptor signaling pathway     101545059 (FOS)    04658 Th1 and Th2 cell differentiation     101545059 (FOS)    04659 Th17 cell differentiation     101545059 (FOS)    04657 IL-17 signaling pathway     101545059 (FOS)    04662 B cell receptor signaling pathway     101545059 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     101545059 (FOS)    04917 Prolactin signaling pathway     101545059 (FOS)    04921 Oxytocin signaling pathway     101545059 (FOS)    04926 Relaxin signaling pathway     101545059 (FOS)    04935 Growth hormone synthesis, secretion and action     101545059 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     101545059 (FOS)   09156 Nervous system    04725 Cholinergic synapse     101545059 (FOS)    04728 Dopaminergic synapse     101545059 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     101545059 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     101545059 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101545059 (FOS)    05207 Chemical carcinogenesis - receptor activation     101545059 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     101545059 (FOS)    05231 Choline metabolism in cancer     101545059 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101545059 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     101545059 (FOS)    05224 Breast cancer     101545059 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101545059 (FOS)    05170 Human immunodeficiency virus 1 infection     101545059 (FOS)    05161 Hepatitis B     101545059 (FOS)    05171 Coronavirus disease - COVID-19     101545059 (FOS)    05162 Measles     101545059 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     101545059 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     101545059 (FOS)    05135 Yersinia infection     101545059 (FOS)    05133 Pertussis     101545059 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     101545059 (FOS)    05142 Chagas disease     101545059 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     101545059 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     101545059 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101545059 (FOS)    05418 Fluid shear stress and atherosclerosis     101545059 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     101545059 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     101545059 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:sara03000]     101545059 (FOS)    04131 Membrane trafficking [BR:sara04131]     101545059 (FOS) Transcription factors [BR:sara03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     101545059 (FOS) Membrane trafficking [BR:sara04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     101545059 (FOS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 Macoilin HALZ DUF4407 Motif Other DBs NCBI-GeneID:  101545059 NCBI-ProteinID:  XP_004610276 LinkDB All DBs Position Unknown AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCADLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHSYGVATPAAGPYSRPGSVKTMSGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDPGFPEEMSVTSLDLSGGLTQATSPDSEEAFT LPLLNDPEPKPAVEPVKSISSVEMKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcttcctcctcccgctgcagcagcgcc tccccagccggggacagtctctcctactaccactcgccggccgactccttctccagcatg ggctctcccgtcaatgcgcaggacttttgcgcggatctggccgtctccagtgccaacttc attcccacggtgactgccatctccaccagcccggacctgcagtggctggtgcagcctacc ctggtttcctccgtggccccgtcccagacgagagccccccactcctacggagtggccacc cctgcggccgggccttactccaggcctgggtcggtgaagactatgagcggcggccgggcg cagagcatcggcaggcggggcaaggtggaacagctgtccccggaagaagaggagaaaagg agaatccgaagggaaaggaataagatggcagcagctaagtgccggaaccgaaggcgggag ctgacagacaccctccaagcggagactgaccaactggaggacgagaaatcagccttgcag actgagatcgccaacttgctgaaggagaaggagaaactcgagtttatcctggcagcccac cggccggcctgcaagatcccagatgacccaggcttcccagaagagatgtctgtgacttct cttgatctgagcgggggcctgacccaagcgaccagccccgactcggaggaggccttcacc ttgcccctcctcaatgaccccgagcccaagcccgccgtggagccggtcaagagcatcagc agcgtggagatgaaggctgagcccttcgatgacttcctgttccccgcctcgtccaggccc agcggctctgagaccgcccgctccgtgcccgacatggacttgtctggttccttctatgca gcagactgggagccgctgcacagtggttccctggggatggggcccatggccacagagctg gagcccctgtgcaccccagtggtcacctgtactcccagctgcactacctacacgtcttcc ttcgtcttcacctacccagaggccgactccttccccagctgcgccgcagcccaccgcaag ggcagcagcagcaacgagccctcctctgactcgctcagctcccccacgctgctggccctg tga

DBGET integrated database retrieval system