Sorex araneus (European shrew): 101548268 Help Entry 101548268         CDS       T07854                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism sara  Sorex araneus (European shrew) Pathway sara04060   Cytokine-cytokine receptor interaction sara04151   PI3K-Akt signaling pathway sara04217   Necroptosis sara04380   Osteoclast differentiation sara04620   Toll-like receptor signaling pathway sara04621   NOD-like receptor signaling pathway sara04622   RIG-I-like receptor signaling pathway sara04623   Cytosolic DNA-sensing pathway sara04630   JAK-STAT signaling pathway sara04650   Natural killer cell mediated cytotoxicity sara04668   TNF signaling pathway sara04936   Alcoholic liver disease sara05135   Yersinia infection sara05142   Chagas disease sara05152   Tuberculosis sara05160   Hepatitis C sara05161   Hepatitis B sara05162   Measles sara05163   Human cytomegalovirus infection sara05164   Influenza A sara05165   Human papillomavirus infection sara05167   Kaposi sarcoma-associated herpesvirus infection sara05168   Herpes simplex virus 1 infection sara05169   Epstein-Barr virus infection sara05170   Human immunodeficiency virus 1 infection sara05171   Coronavirus disease - COVID-19 sara05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101548268 (IFNB1)    04668 TNF signaling pathway     101548268 (IFNB1)    04151 PI3K-Akt signaling pathway     101548268 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101548268 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101548268 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101548268 (IFNB1)    04621 NOD-like receptor signaling pathway     101548268 (IFNB1)    04622 RIG-I-like receptor signaling pathway     101548268 (IFNB1)    04623 Cytosolic DNA-sensing pathway     101548268 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     101548268 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     101548268 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101548268 (IFNB1)    05161 Hepatitis B     101548268 (IFNB1)    05160 Hepatitis C     101548268 (IFNB1)    05171 Coronavirus disease - COVID-19     101548268 (IFNB1)    05164 Influenza A     101548268 (IFNB1)    05162 Measles     101548268 (IFNB1)    05168 Herpes simplex virus 1 infection     101548268 (IFNB1)    05163 Human cytomegalovirus infection     101548268 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     101548268 (IFNB1)    05169 Epstein-Barr virus infection     101548268 (IFNB1)    05165 Human papillomavirus infection     101548268 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     101548268 (IFNB1)    05152 Tuberculosis     101548268 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     101548268 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101548268 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101548268 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sara04052]     101548268 (IFNB1) Cytokines and neuropeptides [BR:sara04052]  Cytokines   Interferons    101548268 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon DUF7605 PIN_8 Peptidase_C101 Poty_PP Motif Other DBs NCBI-GeneID:  101548268 NCBI-ProteinID:  XP_004600410 UniProt:  A0A7R8C3U1 LinkDB All DBs Position Unknown AA seq 190 aa AA seqDB search MANRYILQIALLLCFSSTAFSMSYHLLRSRQRSSNLACQRILNELNGTLTECLQQRIDST IPEEIQQPQLLQKEDILLVTYVMLQQIFGIFSRNFSQTAWNESITEKLFSELQQQMDYLE TTLKERKEVERTKEDVIRCDRIISRLKNYYSRLLKYLKASGYSSCAWVIVKTDILRNFFF LNRLTNYLPD NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atggccaacaggtacatcctccaaattgctctcctattatgcttctccagcacagccttt tctatgagctatcacttgcttcgatccagacaaagaagcagcaatttggcctgtcagagg attctgaatgagttgaatggaacccttacagaatgcctccagcagaggatcgacagcacc atcccggaggagattcaacaacctcagctcctccagaaggaagacatcctattagtcacc tacgtgatgcttcagcagatcttcggaatattcagcagaaatttctctcagactgcctgg aatgagagcatcactgagaaactcttctcagaactccaacagcagatggactatctggag accaccctgaaggaaagaaaggaagtggaaagaacgaaagaagatgtcatcaggtgtgac aggattatttcacgtctgaagaactattactcaaggctcctgaagtacctaaaggccagt ggatatagtagctgtgcctgggtaatagtcaaaacagacatcctcaggaactttttcttc cttaacagacttacaaattacctcccagactga

DBGET integrated database retrieval system