Sorex araneus (European shrew): 101554111 Help Entry 101554111         CDS       T07854                                  Name (RefSeq) RING-box protein 1-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sara  Sorex araneus (European shrew) Pathway sara03420   Nucleotide excision repair sara04066   HIF-1 signaling pathway sara04110   Cell cycle sara04114   Oocyte meiosis sara04120   Ubiquitin mediated proteolysis sara04141   Protein processing in endoplasmic reticulum sara04310   Wnt signaling pathway sara04350   TGF-beta signaling pathway sara04710   Circadian rhythm sara05170   Human immunodeficiency virus 1 infection sara05200   Pathways in cancer sara05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:sara00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101554111    04120 Ubiquitin mediated proteolysis     101554111   09124 Replication and repair    03420 Nucleotide excision repair     101554111  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     101554111    04350 TGF-beta signaling pathway     101554111    04066 HIF-1 signaling pathway     101554111  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     101554111    04114 Oocyte meiosis     101554111  09150 Organismal Systems   09159 Environmental adaptation    04710 Circadian rhythm     101554111  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101554111   09162 Cancer: specific types    05211 Renal cell carcinoma     101554111   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101554111  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sara04121]     101554111    03400 DNA repair and recombination proteins [BR:sara03400]     101554111 Enzymes [BR:sara01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      101554111 Ubiquitin system [BR:sara04121]  Ubiquitin ligases (E3)   UBL E3 ligases    101554111   Multi subunit type E3    SCF complex     Ring finger protein      101554111    Cul2 complex      101554111    Cul3 complex      101554111    Cul4 complex      101554111    Cul7 complex      101554111    Cul8 complex      101554111    Cul9 complex      101554111 DNA repair and recombination proteins [BR:sara03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       101554111     TCR (transcription coupled repair) factors      Cul4-CSA complex       101554111 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-RING_16 zf-C3HC4_2 zf-C3HC4 FANCL_C Motif Other DBs NCBI-GeneID:  101554111 NCBI-ProteinID:  XP_004622739 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MDVDTQSTSQESGVPKERFQLKKWNAVAMWAWDIAVDNCAVCRNHIMELCIECQASQGTV PHEECNVAWGVCNHAFHFHCISRWLKTRHVCPLDNREWEFQKYGK NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggacgtggacacgcagtccacatcgcaggagtcaggtgtgcccaaggaacggttccag ttgaagaaatggaacgcggtggcaatgtgggcctgggatattgccgtggacaattgcgcc gtatgtcgcaatcacatcatggagctgtgcattgaatgccaggcgtcccagggaaccgta ccgcacgaggaatgcaatgtcgcctggggcgtttgcaatcacgcctttcattttcactgc atttcccgctggctgaagacgcgtcacgtttgtccgttggacaaccgcgaatgggaattc caaaaatatggaaaataa

DBGET integrated database retrieval system