Sorex araneus (European shrew): 101555369 Help Entry 101555369         CDS       T07854                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism sara  Sorex araneus (European shrew) Pathway sara01521   EGFR tyrosine kinase inhibitor resistance sara04010   MAPK signaling pathway sara04014   Ras signaling pathway sara04015   Rap1 signaling pathway sara04020   Calcium signaling pathway sara04151   PI3K-Akt signaling pathway sara04550   Signaling pathways regulating pluripotency of stem cells sara04810   Regulation of actin cytoskeleton sara05167   Kaposi sarcoma-associated herpesvirus infection sara05200   Pathways in cancer sara05205   Proteoglycans in cancer sara05207   Chemical carcinogenesis - receptor activation sara05218   Melanoma sara05224   Breast cancer sara05226   Gastric cancer Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101555369 (FGF2)    04014 Ras signaling pathway     101555369 (FGF2)    04015 Rap1 signaling pathway     101555369 (FGF2)    04020 Calcium signaling pathway     101555369 (FGF2)    04151 PI3K-Akt signaling pathway     101555369 (FGF2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     101555369 (FGF2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101555369 (FGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101555369 (FGF2)    05205 Proteoglycans in cancer     101555369 (FGF2)    05207 Chemical carcinogenesis - receptor activation     101555369 (FGF2)   09162 Cancer: specific types    05226 Gastric cancer     101555369 (FGF2)    05218 Melanoma     101555369 (FGF2)    05224 Breast cancer     101555369 (FGF2)   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     101555369 (FGF2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101555369 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sara04052]     101555369 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:sara00536]     101555369 (FGF2) Cytokines and neuropeptides [BR:sara04052]  Cytokines   Growth factors (RTK binding)    101555369 (FGF2) Glycosaminoglycan binding proteins [BR:sara00536]  Heparan sulfate / Heparin   Growth factors/receptors    101555369 (FGF2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF IL1 Motif Other DBs NCBI-GeneID:  101555369 NCBI-ProteinID:  XP_004606344 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MPSGALESALQLRALPGWHGSCHQPDRLGRDWNTVKLQLQAEERGVVSIKGVSANRYLAM KDDGRLLALKCVTDECFFLERLESNNYNTYRSRKYSGWYVALKRTGQCKLGPRTGPGQKA ILFLPMSAKS NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgccgtctggggccttggagtcagccctgcagctgcgggctctgcccggctggcacgga tcttgccatcagccagaccgtctgggcagggactggaacacagtcaagctgcagctgcag gccgaggagcgaggggtcgtgtccatcaagggcgtgagcgccaaccgctacctggccatg aaggacgatggacggctgctggctctgaaatgcgtgacggacgagtgcttcttcctggag cggctggagtccaataactacaacacctaccgctcacgcaagtactcgggctggtacgtg gccctcaagcgcaccgggcagtgcaagctggggccccggacgggcccggggcagaaggcc atcctgttcctccccatgtcggccaagagctga

DBGET integrated database retrieval system