Sorex araneus (European shrew): 101559274 Help Entry 101559274         CDS       T07854                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism sara  Sorex araneus (European shrew) Pathway sara01522   Endocrine resistance sara04110   Cell cycle sara04115   p53 signaling pathway sara04151   PI3K-Akt signaling pathway sara04218   Cellular senescence sara04530   Tight junction sara04660   T cell receptor signaling pathway sara04933   AGE-RAGE signaling pathway in diabetic complications sara04934   Cushing syndrome sara05160   Hepatitis C sara05162   Measles sara05163   Human cytomegalovirus infection sara05164   Influenza A sara05165   Human papillomavirus infection sara05166   Human T-cell leukemia virus 1 infection sara05167   Kaposi sarcoma-associated herpesvirus infection sara05169   Epstein-Barr virus infection sara05200   Pathways in cancer sara05203   Viral carcinogenesis sara05212   Pancreatic cancer sara05214   Glioma sara05218   Melanoma sara05219   Bladder cancer sara05220   Chronic myeloid leukemia sara05222   Small cell lung cancer sara05223   Non-small cell lung cancer sara05224   Breast cancer sara05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     101559274 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     101559274 (CDK4)    04115 p53 signaling pathway     101559274 (CDK4)    04218 Cellular senescence     101559274 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     101559274 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     101559274 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101559274 (CDK4)    05203 Viral carcinogenesis     101559274 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     101559274 (CDK4)    05225 Hepatocellular carcinoma     101559274 (CDK4)    05214 Glioma     101559274 (CDK4)    05220 Chronic myeloid leukemia     101559274 (CDK4)    05218 Melanoma     101559274 (CDK4)    05219 Bladder cancer     101559274 (CDK4)    05224 Breast cancer     101559274 (CDK4)    05222 Small cell lung cancer     101559274 (CDK4)    05223 Non-small cell lung cancer     101559274 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101559274 (CDK4)    05160 Hepatitis C     101559274 (CDK4)    05164 Influenza A     101559274 (CDK4)    05162 Measles     101559274 (CDK4)    05163 Human cytomegalovirus infection     101559274 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     101559274 (CDK4)    05169 Epstein-Barr virus infection     101559274 (CDK4)    05165 Human papillomavirus infection     101559274 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     101559274 (CDK4)    04934 Cushing syndrome     101559274 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     101559274 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:sara01001]     101559274 (CDK4) Enzymes [BR:sara01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      101559274 (CDK4) Protein kinases [BR:sara01001]  Serine/threonine kinases: CMGC group   CDK family    101559274 (CDK4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kdo ABC1 Kinase-like Motif Other DBs NCBI-GeneID:  101559274 NCBI-ProteinID:  XP_004601709 LinkDB All DBs Position Unknown AA seq 303 aa AA seqDB search MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGEGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL MCQFLRGLDFLHANCIVHRDLKPENILVTSSGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEEDWPR DVSLPRGAFSPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHPYLQNGEG NPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacctcccgctatgagccagtggccgagattggcgtcggtgcctacgggacggtg tacaaggcccgcgatccccacagcggccactttgtggccctcaaaagcgtgagagtcccc aacggagaaggtgctggaggaggcctgcccatcagcaccgtccgggaggtggcattgctc aggcggctggaggcttttgagcatcccaatgttgttcggctgatggacgtctgtgccacc gcccggactgaccgggagaccaaagtgaccctggtatttgagcatgtggaccaagacctg aggacttacctggataaggcccccccaccagggttgccggtggagaccatcaaggatctg atgtgccagttcctaagaggcctggattttcttcatgccaactgcatcgttcaccgggac ctgaagccagagaacattctggtgacaagtagcggaacagtcaagctggctgactttggc ctggcgagaatctacagctaccagatggccctcacgcctgtggttgttacactctggtac cgcgccccggaagttcttctgcaatctacatacgcgaccccagtggacatgtggagcgtt ggctgtatcttcgccgagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct gaccagctaggcaagatctttgacctgatcgggctgcccccagaagaagactggcctcga gatgtgtctctcccgagaggagccttttctcccagagggccccgcccggtgcagtcggtg gtacccgagatggaagagtctggggcacagctcctgctggagatgctgacttttaaccca cacaagcgaatctctgccttccgagccctgcagcacccttacctacagaatggagaaggc aacccagagtga

DBGET integrated database retrieval system