Sorex araneus (European shrew): 105943341 Help Entry 105943341         CDS       T07854                                  Symbol GPHA2 Name (RefSeq) glycoprotein hormone alpha-2   KO K25483   glycoprotein hormone alpha-2 Organism sara  Sorex araneus (European shrew) Pathway sara04024   cAMP signaling pathway sara04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     105943341 (GPHA2)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     105943341 (GPHA2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sara04052]     105943341 (GPHA2) Cytokines and neuropeptides [BR:sara04052]  Neuropeptides   GPCR binding    105943341 (GPHA2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_6 Motif Other DBs NCBI-GeneID:  105943341 NCBI-ProteinID:  XP_012790405 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MLMAALQALLLSLLVLTGGRGQQAAPPGCRLYPFNVTVRSDRQGTCQGAHMAQACVGHCE SSAFPSRHSVLAASGYRHNITSVSQCCTISGLRKV NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgctcatggcggccctccaggcgctgctcctcagcctgctggtgctcactggtggccgg gggcagcaggcagcccccccaggctgccgcttgtaccccttcaacgtgacggtgcgcagt gaccgccaaggcacctgccagggcgcgcacatggcccaggcctgcgtaggccactgcgag tccagcgccttcccgtcccggcactcggtgctggcggccagcggctaccggcacaacatc acctccgtgtcgcagtgctgcaccatcagcggcctgaggaaggtg

DBGET integrated database retrieval system