Salmo salar (Atlantic salmon): 100136528 Help Entry 100136528         CDS       T04363                                  Symbol ran1, ran Name (RefSeq) Ran protein   KO K07936   GTP-binding nuclear protein Ran Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa03008   Ribosome biogenesis in eukaryotes sasa03013   Nucleocytoplasmic transport sasa03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:sasa00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     100136528 (ran1)    03008 Ribosome biogenesis in eukaryotes     100136528 (ran1)   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     100136528 (ran1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sasa03019]     100136528 (ran1)    03009 Ribosome biogenesis [BR:sasa03009]     100136528 (ran1)    03016 Transfer RNA biogenesis [BR:sasa03016]     100136528 (ran1)    03036 Chromosome and associated proteins [BR:sasa03036]     100136528 (ran1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     100136528 (ran1)    04031 GTP-binding proteins [BR:sasa04031]     100136528 (ran1) Messenger RNA biogenesis [BR:sasa03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      100136528 (ran1) Ribosome biogenesis [BR:sasa03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     100136528 (ran1)   Pre-60S particles     100136528 (ran1) Transfer RNA biogenesis [BR:sasa03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     100136528 (ran1) Chromosome and associated proteins [BR:sasa03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      100136528 (ran1)    Spindle formation proteins     100136528 (ran1) Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100136528 (ran1) GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Ran Family    Ran     100136528 (ran1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RNA_helicase G-alpha AAA_24 Gtr1_RagA Pox_A32 ArgoMid AAA_7 Septin AAA_16 AAA_22 TsaE AAA_33 DUF5906 SRPRB Motif Other DBs NCBI-GeneID:  100136528 NCBI-ProteinID:  NP_001117103 UniProt:  Q9YGC0 B9ELU2 LinkDB All DBs Position ssa09:60968776..60972539 Genome browser AA seq 215 aa AA seqDB search MAEGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGAIKY NVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCG NKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPA LAPPEILMDPSLAAQYEHDLKVASETALPDEDDDL NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggcagagggagagccacaggtccagttcaagcttgtgttggttggcgatggaggaacg ggaaagaccactttcgtcaaaagacatttaacgggagagtttgagaagaaatatgttgcc acgctgggagtggaggtgcacccgctggtcttccacaccaacagaggggccatcaaatac aatgtgtgggacacagccgggcaggagaagtttggagggctccgagatggctactacatc caagcccagtgtgcgatcatcatgtttgatgtcacgtcccgagtcacctacaagaacgta cccaactggcatcgcgatctggtgcgcgtctgtgagaacattcccatagtcctctgcggc aacaaggtagacatcaaagacaggaaagtcaaagccaagagcatcgtattccatcgcaag aagaacctccagtactacgacatctctgccaagagtaattacaactttgagaagcccttc ctgtggctagcacggaagctgattggagaccccaacctggagttcgtggccatgcccgct ctcgccccaccagagatcctcatggacccctccctcgcagcgcagtacgagcatgacctg aaagttgcatcagaaacagcgctcccagatgaagatgatgacctttaa

DBGET integrated database retrieval system