Salmo salar (Atlantic salmon): 100196560 Help Entry 100196560         CDS       T04363                                  Symbol ran Name (RefSeq) ras-related nuclear protein   KO K07936   GTP-binding nuclear protein Ran Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa03008   Ribosome biogenesis in eukaryotes sasa03013   Nucleocytoplasmic transport sasa03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:sasa00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     100196560 (ran)    03008 Ribosome biogenesis in eukaryotes     100196560 (ran)   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     100196560 (ran)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sasa03019]     100196560 (ran)    03009 Ribosome biogenesis [BR:sasa03009]     100196560 (ran)    03016 Transfer RNA biogenesis [BR:sasa03016]     100196560 (ran)    03036 Chromosome and associated proteins [BR:sasa03036]     100196560 (ran)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     100196560 (ran)    04031 GTP-binding proteins [BR:sasa04031]     100196560 (ran) Messenger RNA biogenesis [BR:sasa03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      100196560 (ran) Ribosome biogenesis [BR:sasa03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     100196560 (ran)   Pre-60S particles     100196560 (ran) Transfer RNA biogenesis [BR:sasa03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     100196560 (ran) Chromosome and associated proteins [BR:sasa03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      100196560 (ran)    Spindle formation proteins     100196560 (ran) Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100196560 (ran) GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Ran Family    Ran     100196560 (ran) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RNA_helicase Gtr1_RagA G-alpha ArgoMid AAA_24 AAA_33 Septin Pox_A32 AAA_22 AAA_7 TsaE Motif Other DBs NCBI-GeneID:  100196560 NCBI-ProteinID:  NP_001135061 UniProt:  B5XGS6 LinkDB All DBs Position ssa04:complement(16072234..16083309) Genome browser AA seq 213 aa AA seqDB search MAEPDVQFKLVLCGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTTRGTIKYNV WDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNK VDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVEMPALA PPEVVMDATLAAQYENDLKVAAETALPDEDDDL NT seq 642 nt NT seq  +upstreamnt  +downstreamnt atggcagaaccagatgtacagtttaagctcgtgttgtgcggagatggaggcacaggaaaa accaccttcgtgaagaggcatttaacgggagagtttgaaaagaaatacgttgcgactctg ggagtagaggtgcaccccttggtcttccacaccactcgagggaccatcaagtacaacgtc tgggacacagccggccaggagaagtttggagggctcagagatggctactacatacaggcc cagtgtgcgatcatcatgttcgacgtcacatctcgcgtcacctacaagaacgtgcccaac tggcaccgcgacctggtgcgcgtctgcgagaacatacccatagtcctgtgcggaaacaag gtggacatcaaggacaggaaggtcaaagccaagagcatcgttttccaccgcaagaagaac cttcagtactacgacatctcagccaagagtaactacaactttgaaaagcccttcctgtgg ctggccaggaagctggtaggagaccccaacctagagtttgtggagatgccagccctcgcc cccccggaggtcgtcatggacgccaccctggccgcgcagtacgagaatgaccttaaagtt gccgcagaaactgctcttccagatgaagacgacgacctttaa

DBGET integrated database retrieval system