Salmo salar (Atlantic salmon): 106601243 Help Entry 106601243         CDS       T04363                                  Symbol rbx1 Name (RefSeq) ring-box 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa03420   Nucleotide excision repair sasa04110   Cell cycle sasa04114   Oocyte meiosis sasa04120   Ubiquitin mediated proteolysis sasa04141   Protein processing in endoplasmic reticulum sasa04310   Wnt signaling pathway sasa04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:sasa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     106601243 (rbx1)    04120 Ubiquitin mediated proteolysis     106601243 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     106601243 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     106601243 (rbx1)    04350 TGF-beta signaling pathway     106601243 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     106601243 (rbx1)    04114 Oocyte meiosis     106601243 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sasa04121]     106601243 (rbx1)    03400 DNA repair and recombination proteins [BR:sasa03400]     106601243 (rbx1) Enzymes [BR:sasa01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      106601243 (rbx1) Ubiquitin system [BR:sasa04121]  Ubiquitin ligases (E3)   UBL E3 ligases    106601243 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      106601243 (rbx1)    Cul2 complex      106601243 (rbx1)    Cul3 complex      106601243 (rbx1)    Cul4 complex      106601243 (rbx1)    Cul7 complex      106601243 (rbx1)    Cul8 complex      106601243 (rbx1)    Cul9 complex      106601243 (rbx1) DNA repair and recombination proteins [BR:sasa03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       106601243 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       106601243 (rbx1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Arif-1 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  106601243 NCBI-ProteinID:  XP_014048765 UniProt:  Q8QG64 B5X694 LinkDB All DBs Position ssa03:65598456..65602936 Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSATNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcagcgatggatgttgataccccaagcgccacgaatagtggagcaagcaagaaa cgttttgaagtgaagaagtggaatgcagtggcactttgggcctgggacattgtggtggac aactgtgccatctgtaggaatcacattatggatctctgcatagagtgccaggctaaccag gcctctgccacatcagaggagtgcaccgtagcctggggagtctgcaatcatgcattccat ttccactgtatctcccgttggttgaagaccaggcaggtgtgccccctagacaacagggag tgggagtttcagaaatatggacactag

DBGET integrated database retrieval system