Sylvia atricapilla (blackcap): 136360734 Help Entry 136360734         CDS       T10263                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism sati  Sylvia atricapilla (blackcap) Pathway sati04060   Cytokine-cytokine receptor interaction sati04218   Cellular senescence sati04620   Toll-like receptor signaling pathway sati04621   NOD-like receptor signaling pathway sati04622   RIG-I-like receptor signaling pathway sati05132   Salmonella infection sati05164   Influenza A Brite KEGG Orthology (KO) [BR:sati00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136360734  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     136360734  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     136360734    04621 NOD-like receptor signaling pathway     136360734    04622 RIG-I-like receptor signaling pathway     136360734  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     136360734   09171 Infectious disease: bacterial    05132 Salmonella infection     136360734  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sati04052]     136360734    00536 Glycosaminoglycan binding proteins [BR:sati00536]     136360734 Cytokines and neuropeptides [BR:sati04052]  Cytokines   Chemokines    136360734 Glycosaminoglycan binding proteins [BR:sati00536]  Heparan sulfate / Heparin   Chemokines    136360734 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  136360734 NCBI-ProteinID:  XP_066174344 LinkDB All DBs Position 4:69047078..69049131 Genome browser AA seq 103 aa AA seqDB search MIKTVAVVLMLLLISALGTQGEAVPRSAIELRCQCISTHSKFIHPKFIQNVNLTPSGPHC KNVEVIATLRDGREVCLEPTAPWVKLIIKAILDKANTKPKTVS NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgatcaagactgtggctgttgtcctgatgctgctcctgatctcagcacttggaacacaa ggtgaggcagtgccacgatcagccattgaactccggtgccagtgtataagcacccattcc aagttcatccatcccaagttcatccaaaacgtgaacctcacccccagtggacctcactgc aagaatgttgaagtcatagctaccctgagagatggcagagaagtgtgcctggagcccact gctccctgggtgaagctgataatcaaggcaattctggacaaggccaacaccaaacccaag acagtgtcctaa

DBGET integrated database retrieval system