Sylvia atricapilla (blackcap): 136363178 Help Entry 136363178         CDS       T10263                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism sati  Sylvia atricapilla (blackcap) Pathway sati04010   MAPK signaling pathway sati04068   FoxO signaling pathway sati04081   Hormone signaling sati04114   Oocyte meiosis sati04140   Autophagy - animal sati04150   mTOR signaling pathway sati04810   Regulation of actin cytoskeleton sati04910   Insulin signaling pathway sati04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:sati00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     136363178 (INS)    04068 FoxO signaling pathway     136363178 (INS)    04150 mTOR signaling pathway     136363178 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     136363178 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     136363178 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     136363178 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     136363178 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     136363178 (INS)    04914 Progesterone-mediated oocyte maturation     136363178 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sati04052]     136363178 (INS) Cytokines and neuropeptides [BR:sati04052]  Neuropeptides   Unclassified    136363178 (INS) SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  136363178 NCBI-ProteinID:  XP_066178353 UniProt:  A0A7K7DTS3 LinkDB All DBs Position 6:15654792..15657489 Genome browser AA seq 107 aa AA seqDB search MALWIQSLPLLALLALSGPGSSHGAVNQHLCGSHLVEALYLVCGERGFFYQPKARRDLEQ PLVSGPLHGELGELPFQQEEFEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctgtggatccagtcgctgcccctgctggccctcctggccctgtccggccccggg agcagccacggggccgtcaaccagcacctctgcggctcccacctggtggaggctctctac ctggtgtgtggggagcggggcttcttctaccagcccaaggcgcggcgggacctagagcag cctctggtgagcggtcccttgcatggtgagttgggagagctgcccttccagcaggaggag tttgagaaagtgaagagagggattgttgagcaatgctgccacaacacctgctccctctac cagctggaaaactactgcaattag

DBGET integrated database retrieval system