Sorghum bicolor (sorghum): 8073850 Help Entry 8073850           CDS       T01086                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sbi  Sorghum bicolor (sorghum) Pathway sbi03420   Nucleotide excision repair sbi04120   Ubiquitin mediated proteolysis sbi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sbi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     8073850    04120 Ubiquitin mediated proteolysis     8073850   09124 Replication and repair    03420 Nucleotide excision repair     8073850  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sbi04121]     8073850    03400 DNA repair and recombination proteins [BR:sbi03400]     8073850 Enzymes [BR:sbi01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      8073850 Ubiquitin system [BR:sbi04121]  Ubiquitin ligases (E3)   UBL E3 ligases    8073850   Multi subunit type E3    SCF complex     Ring finger protein      8073850    Cul2 complex      8073850    Cul3 complex      8073850    Cul4 complex      8073850    Cul7 complex      8073850    Cul8 complex      8073850    Cul9 complex      8073850 DNA repair and recombination proteins [BR:sbi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       8073850     TCR (transcription coupled repair) factors      Cul4-CSA complex       8073850 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  8073850 NCBI-ProteinID:  XP_002454413 UniProt:  A0A921UK52 A0A1Z5RPL6 LinkDB All DBs Position 4:complement(61026722..61029068) Genome browser AA seq 113 aa AA seqDB search MDKGKGAVVVAPAPAPAAAAGKKAKRFDIKKWNAVSLWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacaagggcaagggcgccgtcgtcgtggccccggccccggcccctgccgctgccgcc gggaagaaggccaagcgcttcgatatcaagaagtggaacgccgtctctctctgggcctgg gacatcgtggtcgacaactgtgccatctgccgcaaccacatcatggacctctgcatcgag tgccaggcgaaccaggcgagcgcaaccagcgaggaatgcaccgtcgcttggggagtttgc aaccatgcgttccacttccactgtatcagtcgttggctaaagacccgtcaagtgtgccct cttgacaacagtgagtgggagttccagaagtatggtcactag

DBGET integrated database retrieval system