Salmonella bongori serovar 48 z41 --: N643_00355 Help Entry N643_00355        CDS       T03249                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism sbv  Salmonella bongori serovar 48:z41:-- Pathway sbv00670   One carbon pool by folate sbv00790   Folate biosynthesis sbv01100   Metabolic pathways sbv01240   Biosynthesis of cofactors sbv04981   Folate transport and metabolism Module sbv_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:sbv00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     N643_00355 (folA)    00670 One carbon pool by folate     N643_00355 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     N643_00355 (folA) Enzymes [BR:sbv01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      N643_00355 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  AID23954 LinkDB All DBs Position 79455..79934 Genome browser AA seq 159 aa AA seqDB search MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRHTWESIGRPLPGRKNI VISSQSGTDDRVQWVRSVDEAIAACGNAPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE GDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgattagtctgattgcggcgttagcggtggatcgcgtcatcggtatggaaaacgccatg ccgtggaacctgcctgccgatctcgcctggtttaaacgtaacacgttaaataaacctgtc gtcatgggacgtcacacctgggagtccattgggcgtccgttaccagggcgtaaaaatatt gtcatcagtagccaatcgggcaccgacgatcgcgtgcagtgggtgaggtctgttgatgag gcgatagccgcatgtggcaatgcgccagaaattatggtcattggcggtgggcgtgtgtat gagcagtttttgcccaaagcgcagaagctttatctgacgcatattgacgcggaagttgaa ggcgatacccattttccggattatgaaccggatgactgggagtcggtattcagcgaattt catgatgccgatgcgcagaactctcatagctattgtttcgagattcttgagcgtcgctaa

DBGET integrated database retrieval system